KEGG   Pyrobaculum oguniense: Pogu_1279Help
Entry
Pogu_1279         CDS       T01735                                 

Definition
Asparagine synthase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pog  Pyrobaculum oguniense
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pog00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1097771..1098595
Genome map
AA seq 274 aa AA seqDB search
MILKLLSKYADCDSILLSGGVDSSAVAAATVARGSRPLGVVVSLRGCRSDLPYAAVVSSK
LSIPLSARIVERGEAVRAAEEVVGILKVFNPMEVVNCAVVYLGLSHAASLGAHRVCTGDG
GDELFLGYDFFRRSRDLERTRHDVVGRWRFCSFDIGKALGVEVIAPFTQREVVEYALSIP
AELALGKRPLREELSAILPEVAAREKTPLERGSCFDFLYDEFRRKAGDEVAYLKAVFERI
GLNYPTSLTGCPRCGYAGFDGRYCPMCGYYARGD
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgatccttaagcttctctctaaatacgccgactgcgactccatattactgtccggaggg
gttgactcctcagccgtcgccgcggcaacagtcgcccggggatctaggccccttggcgta
gtggtctcgctccgggggtgtaggtcggacctcccctacgccgccgttgtctccagcaag
ctctctatccccctctctgcgaggattgtggagaggggcgaggctgtgagggcagccgag
gaggtagtggggatcctcaaggtgtttaaccccatggaggtggtgaactgcgccgtcgtg
tacctcggcctctcccacgccgcgtctttaggcgcgcacagggtgtgcacaggtgacggc
ggtgacgagctgtttctcggatacgactttttccgcagaagccgcgatttggagaggacg
aggcatgatgtagttgggaggtggcgcttttgtagcttcgatatcggaaaggccctaggc
gtagaggtaatcgcccccttcacccagagggaggtggtggaatacgcactctctataccc
gccgagctggccctcggaaagagaccgcttagggaggagttatccgccatattgcccgag
gttgcggctagagagaagacgccgttggagaggggaagttgcttcgacttcctctacgac
gagtttaggaggaaggcaggagatgaggtggcctacttaaaggcagttttcgagaggatt
gggttgaactaccccacgtcgcttaccggctgtccgcgttgcggatacgcgggatttgac
gggaggtattgccccatgtgcggctactatgcacggggggactag

DBGET integrated database retrieval system