KEGG   Pyrobaculum oguniense: Pogu_1394Help
Entry
Pogu_1394         CDS       T01735                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pog  Pyrobaculum oguniense
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pogu_1394
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pogu_1394
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pogu_1394
Enzymes [BR:pog01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pogu_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1205631..1206608
Genome map
AA seq 325 aa AA seqDB search
MLPLKKGVSLGEGATPLVKSNLAEGLYVKFEGANPTGSFKDRGMALGVTVARESGANKVV
VASTGNTAASAAAYAARAGMKCYVVLPRGNVARGKLMQAALHGAEIVMVNGLFDKALEYV
VNYGTKYAYPLNSFNPWRLEGQKTVAFEIFEELGCPDYVVVPVGNAGNISAIWKGFKELA
ELGLCNKLPRMVGVQAEGAAPLAEAWERGLEEPLFVDEPRTVATAIKIGRPINWPKAVRA
VKESGGFFIKVQDGEILKAQRELAQRDGIGAEPAGAASVAGYLKAKLRGVVVAVVTGHAL
KDPDAVEISAKEVRNADELMELLEK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgctcccgcttaaaaaaggtgtttctcttggcgaaggcgctaccccacttgttaagtcc
aacttagcagaaggtctatacgtcaagttcgagggggctaaccccaccggcagttttaag
gatcggggcatggcgctgggggtcacagtggcgagggaaagcggtgcgaacaaggtagtc
gtcgcctccacaggcaacacagcggcctccgccgccgcctacgccgctagggcggggatg
aagtgctacgtggtgctgcccaggggcaatgtggcaagggggaagctgatgcaggccgcc
ctccatggggcggagatcgtgatggtcaacggcctcttcgacaaggccctcgagtacgtg
gtgaactacggcactaagtacgcctatcccctaaacagcttcaacccctggcgcctcgag
gggcagaagactgtggcttttgagatatttgaggagctcggttgccccgactacgtggtt
gtgccggtaggcaacgccggcaatatctctgccatctggaaggggtttaaagagctggcg
gagctgggcctgtgtaacaagcttccgcggatggtgggcgtgcaggcagagggcgccgcc
ccgctggccgaggcgtgggagagggggctggaggagcccctattcgtcgacgagccgagg
acagtggcaactgctataaagatcgggaggcctataaactggcccaaggcggttagggcc
gtgaaggagtcaggcggcttctttatcaaggtccaagacggcgaaatcttaaaggcgcaa
cgggagctggcgcagagagacggcataggcgccgagcccgccggggcggcctcggttgca
ggttatttaaaggccaagttaaggggggtcgtggtcgccgtggtgacgggccacgcccta
aaggacccagacgcggtggagatatcggcaaaggaagttaggaacgccgacgagctgatg
gagctgttggagaaatga

DBGET integrated database retrieval system