KEGG   Pyrobaculum oguniense: Pogu_1394Help
Entry
Pogu_1394         CDS       T01735                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pog  Pyrobaculum oguniense
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pogu_1394
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pogu_1394
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pogu_1394
Enzymes [BR:pog01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pogu_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1205631..1206608
Genome map
AA seq 325 aa AA seqDB search
MLPLKKGVSLGEGATPLVKSNLAEGLYVKFEGANPTGSFKDRGMALGVTVARESGANKVV
VASTGNTAASAAAYAARAGMKCYVVLPRGNVARGKLMQAALHGAEIVMVNGLFDKALEYV
VNYGTKYAYPLNSFNPWRLEGQKTVAFEIFEELGCPDYVVVPVGNAGNISAIWKGFKELA
ELGLCNKLPRMVGVQAEGAAPLAEAWERGLEEPLFVDEPRTVATAIKIGRPINWPKAVRA
VKESGGFFIKVQDGEILKAQRELAQRDGIGAEPAGAASVAGYLKAKLRGVVVAVVTGHAL
KDPDAVEISAKEVRNADELMELLEK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgctcccgcttaaaaaaggtgtttctcttggcgaaggcgctaccccacttgttaagtcc
aacttagcagaaggtctatacgtcaagttcgagggggctaaccccaccggcagttttaag
gatcggggcatggcgctgggggtcacagtggcgagggaaagcggtgcgaacaaggtagtc
gtcgcctccacaggcaacacagcggcctccgccgccgcctacgccgctagggcggggatg
aagtgctacgtggtgctgcccaggggcaatgtggcaagggggaagctgatgcaggccgcc
ctccatggggcggagatcgtgatggtcaacggcctcttcgacaaggccctcgagtacgtg
gtgaactacggcactaagtacgcctatcccctaaacagcttcaacccctggcgcctcgag
gggcagaagactgtggcttttgagatatttgaggagctcggttgccccgactacgtggtt
gtgccggtaggcaacgccggcaatatctctgccatctggaaggggtttaaagagctggcg
gagctgggcctgtgtaacaagcttccgcggatggtgggcgtgcaggcagagggcgccgcc
ccgctggccgaggcgtgggagagggggctggaggagcccctattcgtcgacgagccgagg
acagtggcaactgctataaagatcgggaggcctataaactggcccaaggcggttagggcc
gtgaaggagtcaggcggcttctttatcaaggtccaagacggcgaaatcttaaaggcgcaa
cgggagctggcgcagagagacggcataggcgccgagcccgccggggcggcctcggttgca
ggttatttaaaggccaagttaaggggggtcgtggtcgccgtggtgacgggccacgcccta
aaggacccagacgcggtggagatatcggcaaaggaagttaggaacgccgacgagctgatg
gagctgttggagaaatga

DBGET integrated database retrieval system