KEGG   Pyrobaculum oguniense: Pogu_1406Help
Entry
Pogu_1406         CDS       T01735                                 

Definition
acetate--CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pog  Pyrobaculum oguniense
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pogu_1406
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pogu_1406
   00620 Pyruvate metabolism
    Pogu_1406
   00640 Propanoate metabolism
    Pogu_1406
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pogu_1406
   00680 Methane metabolism
    Pogu_1406
Enzymes [BR:pog01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pogu_1406
Lipid biosynthesis proteins [BR:pog01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pogu_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1217517..1219523
Genome map
AA seq 668 aa AA seqDB search
MIAKEKEVELPFEEYVINEKWRGKYTPVDAYWKYHAQTVENLEAFWEGVAKELEWFRPWD
KVLDASNPPFYKWFVGGRLNLSYLAVDRHVKTWRKNKLAIEWEGEPVDENGYPTDRRKLT
YYDLYREVNKVAYMLKNNFGIKKGDRITLYLPMIPELPVTMLAAWRIGAITSVVFSGFSA
DALAERINDSQSRLVITADGFWRRGKVVRLKEVVDAALEKATGVENVIVFPRLGLKDTPM
TEGRDYWWNKLMQGVPHNAYIEPEPVESEHPSFILYTSGTTGKPKGIVHDTGGWAVHVYA
TMKWVFDIRDDDIYWCTADIGWVTGHSYVVLGPLLIGATEVMYEGAPDYPQPDRWWSIIE
RYGVTILYTSPTAIRMFMRYGEEWPRKHDLSTLRIIHSVGEPINPEAWRWAYRVLGGERV
AFGSTWWMTETGGIVISHAPGLYLVPMKPGTNGPPLPGFDVDVVDDEGKPAPPGVKGYLV
IKKPWPGMLHGVWGDPERYIKTYWSRFPGMFYAGDYAIKDKDGFIWVLGRADEVIKVAGH
RLGTYELESALVGHKAVAEAAVIGVPDPIKGEVPIAFVVLKQGVQPSDELRKELRAHIRS
TIGPIAEPAQIFFVTKLPKTRSGKIMRRLLKAVATGAPLGDVTTLEDETSVEEARKAYQE
LKAEIERA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgattgcaaaagagaaagaagtagagttaccatttgaagagtatgtaataaatgagaag
tggcgtgggaaatatacccccgtcgacgcgtattggaaatatcacgcccagactgtagag
aacttagaggcgttttgggagggggtcgccaaggaactggagtggtttaggccttgggac
aaggtacttgacgcctccaacccgcccttttataagtggtttgtgggggggaggctgaac
ttgtcctacctagcagtagacagacatgtaaagacttggcggaagaacaaacttgccatt
gagtgggagggcgagcctgtggacgagaacgggtacccaacggacaggaggaagttgact
tactacgacctctacagagaggtgaataaagtggcgtacatgcttaagaacaatttcggc
atcaagaagggggatagaattaccctgtacctacccatgatccccgagttgcctgtcaca
atgctggcggcgtggagaattggggcaattaccagcgtggtgttctcaggtttctccgca
gatgccttagccgagcgtatcaacgactcccagtcgcgcttggtcataactgcagacggg
ttctggaggaggggcaaggtggtgagacttaaagaggtggtagacgccgctctggagaaa
gccaccggcgtagagaacgtcattgtatttcccaggctggggctaaaagacacccccatg
acagagggcagggactactggtggaataagctaatgcagggggtgcctcacaacgcatat
atagagccagagcctgtggaaagcgagcacccctccttcatactctacacctccggcacc
acgggcaagccaaagggcattgtccacgacactggcggctgggcggttcacgtatacgcc
actatgaagtgggtatttgacataagggacgacgacatttactggtgcacggcagacatt
gggtgggtcactggacactcctacgtggtgctcggcccattgcttattggcgctaccgag
gtcatgtacgagggcgcgccggattatccgcagccagacaggtggtggtctattatagag
cgctacggcgtgacgattctctacacctcgcccacagccattaggatgtttatgcgctat
ggcgaggagtggccgaggaaacacgacctctccactctaaggataatacactcagtgggc
gaacccataaacccagaggcgtggaggtgggcctatagagtactgggaggggagagagtg
gcctttggctccacttggtggatgaccgagacggggggcattgtaataagccacgcccca
ggcctctacctagtccccatgaagcccggcactaacgggccgccgctcccaggctttgac
gtagacgtagtagacgacgagggaaagccggcgccccccggagtaaagggctacttagta
ataaagaagccatggccaggtatgctccacggagtctggggggatccagagaggtacata
aagacctactggtctaggttcccaggcatgttctacgcaggcgactatgccataaaagac
aaagacggcttcatatgggtactaggcagagccgacgaggtcattaaagtggcaggccac
cgcttgggcacctacgagcttgagtcggcgcttgtcggccacaaggccgtggcagaagcc
gccgtaataggcgtaccagatcccataaagggcgaggtgcccatagccttcgtggtgtta
aaacaaggcgtacagccctcagacgagttgcgaaaagagctgagggcccacatacgttcc
accattggccccattgcagagccggcgcagatattcttcgtcacaaagttgcccaagacg
cgctctggtaagattatgcgccgcctgctaaaggctgtggccaccggcgcgcctttggga
gacgtcaccaccttggaagacgagacgtccgtagaagaggcgagaaaagcctaccaagag
ctaaaagcagagatagagagggcatga

DBGET integrated database retrieval system