KEGG   Pyrobaculum oguniense: Pogu_1406Help
Entry
Pogu_1406         CDS       T01735                                 

Definition
(RefSeq) acetate--CoA ligase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pog  Pyrobaculum oguniense
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pogu_1406
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pogu_1406
   00620 Pyruvate metabolism
    Pogu_1406
   00640 Propanoate metabolism
    Pogu_1406
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pogu_1406
   00680 Methane metabolism
    Pogu_1406
Enzymes [BR:pog01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pogu_1406
Lipid biosynthesis proteins [BR:pog01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pogu_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1217517..1219523
Genome map
AA seq 668 aa AA seqDB search
MIAKEKEVELPFEEYVINEKWRGKYTPVDAYWKYHAQTVENLEAFWEGVAKELEWFRPWD
KVLDASNPPFYKWFVGGRLNLSYLAVDRHVKTWRKNKLAIEWEGEPVDENGYPTDRRKLT
YYDLYREVNKVAYMLKNNFGIKKGDRITLYLPMIPELPVTMLAAWRIGAITSVVFSGFSA
DALAERINDSQSRLVITADGFWRRGKVVRLKEVVDAALEKATGVENVIVFPRLGLKDTPM
TEGRDYWWNKLMQGVPHNAYIEPEPVESEHPSFILYTSGTTGKPKGIVHDTGGWAVHVYA
TMKWVFDIRDDDIYWCTADIGWVTGHSYVVLGPLLIGATEVMYEGAPDYPQPDRWWSIIE
RYGVTILYTSPTAIRMFMRYGEEWPRKHDLSTLRIIHSVGEPINPEAWRWAYRVLGGERV
AFGSTWWMTETGGIVISHAPGLYLVPMKPGTNGPPLPGFDVDVVDDEGKPAPPGVKGYLV
IKKPWPGMLHGVWGDPERYIKTYWSRFPGMFYAGDYAIKDKDGFIWVLGRADEVIKVAGH
RLGTYELESALVGHKAVAEAAVIGVPDPIKGEVPIAFVVLKQGVQPSDELRKELRAHIRS
TIGPIAEPAQIFFVTKLPKTRSGKIMRRLLKAVATGAPLGDVTTLEDETSVEEARKAYQE
LKAEIERA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgattgcaaaagagaaagaagtagagttaccatttgaagagtatgtaataaatgagaag
tggcgtgggaaatatacccccgtcgacgcgtattggaaatatcacgcccagactgtagag
aacttagaggcgttttgggagggggtcgccaaggaactggagtggtttaggccttgggac
aaggtacttgacgcctccaacccgcccttttataagtggtttgtgggggggaggctgaac
ttgtcctacctagcagtagacagacatgtaaagacttggcggaagaacaaacttgccatt
gagtgggagggcgagcctgtggacgagaacgggtacccaacggacaggaggaagttgact
tactacgacctctacagagaggtgaataaagtggcgtacatgcttaagaacaatttcggc
atcaagaagggggatagaattaccctgtacctacccatgatccccgagttgcctgtcaca
atgctggcggcgtggagaattggggcaattaccagcgtggtgttctcaggtttctccgca
gatgccttagccgagcgtatcaacgactcccagtcgcgcttggtcataactgcagacggg
ttctggaggaggggcaaggtggtgagacttaaagaggtggtagacgccgctctggagaaa
gccaccggcgtagagaacgtcattgtatttcccaggctggggctaaaagacacccccatg
acagagggcagggactactggtggaataagctaatgcagggggtgcctcacaacgcatat
atagagccagagcctgtggaaagcgagcacccctccttcatactctacacctccggcacc
acgggcaagccaaagggcattgtccacgacactggcggctgggcggttcacgtatacgcc
actatgaagtgggtatttgacataagggacgacgacatttactggtgcacggcagacatt
gggtgggtcactggacactcctacgtggtgctcggcccattgcttattggcgctaccgag
gtcatgtacgagggcgcgccggattatccgcagccagacaggtggtggtctattatagag
cgctacggcgtgacgattctctacacctcgcccacagccattaggatgtttatgcgctat
ggcgaggagtggccgaggaaacacgacctctccactctaaggataatacactcagtgggc
gaacccataaacccagaggcgtggaggtgggcctatagagtactgggaggggagagagtg
gcctttggctccacttggtggatgaccgagacggggggcattgtaataagccacgcccca
ggcctctacctagtccccatgaagcccggcactaacgggccgccgctcccaggctttgac
gtagacgtagtagacgacgagggaaagccggcgccccccggagtaaagggctacttagta
ataaagaagccatggccaggtatgctccacggagtctggggggatccagagaggtacata
aagacctactggtctaggttcccaggcatgttctacgcaggcgactatgccataaaagac
aaagacggcttcatatgggtactaggcagagccgacgaggtcattaaagtggcaggccac
cgcttgggcacctacgagcttgagtcggcgcttgtcggccacaaggccgtggcagaagcc
gccgtaataggcgtaccagatcccataaagggcgaggtgcccatagccttcgtggtgtta
aaacaaggcgtacagccctcagacgagttgcgaaaagagctgagggcccacatacgttcc
accattggccccattgcagagccggcgcagatattcttcgtcacaaagttgcccaagacg
cgctctggtaagattatgcgccgcctgctaaaggctgtggccaccggcgcgcctttggga
gacgtcaccaccttggaagacgagacgtccgtagaagaggcgagaaaagcctaccaagag
ctaaaagcagagatagagagggcatga

DBGET integrated database retrieval system