KEGG   Pyrobaculum oguniense: Pogu_1600Help
Entry
Pogu_1600         CDS       T01735                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.59)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
pog  Pyrobaculum oguniense
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pogu_1600
   01230 Biosynthesis of amino acids
    Pogu_1600
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pogu_1600
Enzymes [BR:pog01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Pogu_1600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1390635..1391669
Genome map
AA seq 344 aa AA seqDB search
MIRVGIVGFGTIGKRIADAVAAQGDMHVSGVLKVTPDYEALVATAKGFKVYTLPDRVEKF
KKAGIEPAGTIEDLIKASDVIIDASPEDVGAENKEKYYSKFDKPVIFQGGEEAEVADVSF
NALANYDEARGRRYVRVVSCNTTGITRVLTSLMLNGVGIKKARIFIARRGADPKEHKKGP
INDVVPNPATVPSHHGPDVKTVLKNVDIVTMAVAVPVTIMHMHMAYLELDGAYPRDAVLE
ALAKTPRIFLADVGAGFQSLAQIIEYARDLGRPRGDFPEVAIFRDSVTVNGNELYLMYGV
HQESIVVPENVDAVRAVLGAMPKWESIKTTDTTLKLFTEGKRYG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgatcagagtcggcatcgtcgggtttggcaccatcggcaagcgcatcgccgacgcagta
gcggcgcagggcgacatgcacgtctcaggcgttcttaaggtaacgccggattacgaagcc
ctagttgcaactgctaagggcttcaaggtctacaccctccccgaccgcgtcgagaagttc
aaaaaggcgggcatcgagccggcggggacaattgaggacttgataaaggcatctgacgtg
attatagacgcctcgcccgaggacgtaggtgctgaaaacaaggagaagtactactccaaa
tttgacaagcccgtcatattccagggcggcgaagaggcggaggtggctgatgtgagcttc
aacgccctggccaactacgacgaggccagagggaggcggtatgtgagagtcgtcagttgc
aacaccaccggcattaccagggttttgacgtccctaatgctaaacggggtggggataaag
aaggcaaggatcttcatagcgaggaggggggcggaccccaaagagcacaagaaggggccg
atcaacgacgtagtgcccaacccagccactgtgccgagccaccacggccccgacgtgaaa
accgtgttgaagaacgtggacatcgtgacgatggccgtcgcagtccctgtcacaatcatg
cacatgcacatggcgtatctcgaactagacggggcctacccccgcgacgccgtgctggag
gccctcgccaagacgcctagaatcttcctcgcagacgtcggggcgggcttccagagccta
gcccaaattatcgaatacgcccgcgacctaggcaggcccagaggagacttccccgaggtg
gccatattccgcgactcggtgacagtcaacgggaacgagctgtacctcatgtacggcgtc
catcaagagtcaatagtagtgccggaaaacgtagacgccgtcagggccgtgctcggcgca
atgcccaagtgggagtccataaagacgaccgacacaacgcttaaattattcaccgaaggg
aagagatatgggtga

DBGET integrated database retrieval system