KEGG   Pyrobaculum oguniense: Pogu_1657Help
Entry
Pogu_1657         CDS       T01735                                 

Definition
(GenBank) PEP phosphonomutase-related enzyme
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pog  Pyrobaculum oguniense
Pathway
pog00630  Glyoxylate and dicarboxylate metabolism
pog01100  Metabolic pathways
pog01110  Biosynthesis of secondary metabolites
pog01120  Microbial metabolism in diverse environments
pog01200  Carbon metabolism
Module
pog_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pogu_1657
Enzymes [BR:pog01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Pogu_1657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL ComA
Motif
Other DBs
NCBI-ProteinID: AFA39684
UniProt: H6QAQ8
Position
1445360..1446409
Genome map
AA seq 349 aa AA seqDB search
MEKLIGKLDLYEKVLKNPGAEFRRLLKTEPYIFTTGVYTPLQAKLAQIAGLKAVYISGYS
CSVGYLGAADLNILTLEEYVWIARHIANAVTIPVVADAESGFGSLFNAMRAVKEFWRAGV
AAIHVEDQVFPKRCGHLAGKQVMPLEDAVAMFKAIDRVRRNIDPDFFIIARTDAIGASNV
EPERQVDEAIRRAKAYINAGADMVWAEFTRPDDVDAITKFAEGVRKEFPDVPLAFNYSSS
FRWHKSRVPIRFKWLAELGYKYIFITLGALHAETYAVYNFVKDLATRQEEALWELQKLKE
GHPTESHHKLGDFDYFKELEVTFYPWAKVKYERGAGYGSEKEKGDERLV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactgataggtaagctggatctgtatgaaaaggttttaaaaaatcctggtgct
gaatttaggcgtttgttaaaaaccgagccttatatctttaccaccggggtgtatactcct
ctgcaagctaagttggctcaaatcgctggcttaaaggctgtgtacataagcggttattct
tgttctgttggctacctaggcgcggctgatttaaacatcttaacgcttgaagaatatgta
tggatcgcgcgccatatagccaatgccgttacaataccggttgtggcagacgctgaaagc
gggtttggcagcctgtttaatgctatgcgcgctgtgaaggagttttggagagctggggtt
gcggctattcacgtagaggatcaggtgtttccaaaaagatgcggccatcttgcggggaag
caggtaatgcccttggaggatgctgtggccatgtttaaggctattgatagagtgcggcgc
aatattgatccggacttcttcataattgcaagaaccgacgctatcggcgcctctaacgtg
gagcccgagaggcaggttgacgaggctattagaagagctaaggcttatataaacgccggg
gccgacatggtttgggcagagttcacgcgccccgacgatgttgacgctatcacgaaattc
gccgagggcgttaggaaggagttcccagacgtgcctctggcgtttaactattcctcctct
ttcagatggcacaagtctagggttccaatcagattcaaatggcttgccgagcttgggtat
aaatacattttcataactctcggcgcgttacacgccgagacgtacgcagtttataacttt
gtaaaagacttggcgacaagacaggaggaggctctgtgggagttgcaaaagctaaaagag
gggcacccaacggagagccaccataagcttggcgattttgactactttaaggagcttgaa
gtaacgttctacccatgggctaaggttaagtatgaacgcggcgccggctatggctcggag
aaagaaaaaggcgatgagaggttggtatga

DBGET integrated database retrieval system