KEGG   Pyrobaculum oguniense: Pogu_1730Help
Entry
Pogu_1730         CDS       T01735                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pog  Pyrobaculum oguniense
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pogu_1730
   01230 Biosynthesis of amino acids
    Pogu_1730
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pogu_1730
   00051 Fructose and mannose metabolism
    Pogu_1730
   00562 Inositol phosphate metabolism
    Pogu_1730
Enzymes [BR:pog01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pogu_1730
Exosome [BR:pog04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pogu_1730
  Exosomal proteins of bladder cancer cells
   Pogu_1730
  Exosomal proteins of melanoma cells
   Pogu_1730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1500678..1501352)
Genome map
AA seq 224 aa AA seqDB search
MKFPVLILNFKAYAEAAGRRAVEIAKAAERVAKELGVNIAVAPNHLELALVAQSVEIPVY
AQGVDVESPGAHTAHVALGNLKEAGAAGVILNHSEAPLRLNELARYVGRARELGLDVVVC
APDPTTSLAAAALGPHAVAVEPPELIGTGRAVSKYKPETVVKTVQLVGKHFPDVAVITGA
GIESGEDVEAALRLGTRGVLLASAAVKAKDHYQKIMELAKPLLK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttccagtactaatcctgaacttcaaagcgtacgctgaggcggctgggcgcagg
gctgtggagatagcaaaggccgccgagagggttgcgaaggagctgggcgtcaacatcgcc
gtggcgcctaaccacctggagctggccctcgtagcacagagcgtggagatccccgtctac
gcccagggcgtcgacgtggagtcaccgggcgcccacacggcccacgtggcgctgggcaac
ttgaaagaggcgggtgcggctggggttatcctaaaccacagcgaggcgcccctcaggctg
aacgaattggccagatacgtgggaagggcgagggagttgggcctagacgtggtggtctgc
gccccggacccgacaaccagcttggcggcggccgccttgggcccccacgccgttgccgtg
gaaccccctgagcttatcggcacggggcgggcagtctccaagtacaagccggagactgtg
gtcaaaaccgtccagcttgttgggaaacacttcccagatgtggcggttattacaggcgcc
ggcatagagagcggcgaggatgtagaggcggccttaaggctgggaaccaggggcgtgctg
ttggcaagcgccgctgtcaaggcgaaggaccactaccagaagataatggagctcgcgaag
ccgcttctaaagtag

DBGET integrated database retrieval system