KEGG   Pyrobaculum oguniense: Pogu_1860Help
Entry
Pogu_1860         CDS       T01735                                 

Definition
Malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pog  Pyrobaculum oguniense
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:pog01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pog00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pog00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1618232..1620673
Genome map
AA seq 813 aa AA seqDB search
MIEVDSSVLREYGDLFGEKLVNGRRVSVEGLIEELTRELRAEIDRVIRARREWLNDRRPV
RTKAAFPQWDEKFTDADGNVKTFKEIVQGLIDNFLGRETPLRWGLNWNVPVPDDLHPLKN
PGLEITGPWYPMNRAIHQINADVASMMEDEEDASPAWFIPRGSGRTTAAVWEARRIVNKV
LRGDVPQPYYEGGKEYRIKKPREKWPTLIHRVPGLHILDFDIRVDGKPAPAIITSVVIYT
VNNYDLLKKAGSGVYFYVPKVQTPDEALVIEKILRKVEDKLGLRRGELKIAMLYEEARAG
LYLPVIFWIWRERLVKSNNGRWDYLGSLIEMWKDEAVYPDPQNITMTHPVMMAYQKWNAL
MCLMAGLDREGRLNAGPVGGMAAVMLYRADDPYQRHRFNQRALRAIWLDKLRERLIGLIF
VTEEPVKKVTLREVLEGKVKGRLFDLFRQSWVATPEESYVKAGNEPLRASLEELQQMINR
PVKFVEVDGVKIPTVDSGLTEQERQLFIRLGLLDEQGNITPWVIRPDMLDTPEKLLGNPE
LWGGKDLWTALFEPPKGDITAEHIQHAFYMAANYGFQLLNGNLAAAIDDYELGQRFMNDL
ATYRIFSTWLWTLLRHNAVITKDGAFKGPARTGLGVIPAEDRVKVAAGTRFTEELFDKLW
DLHMEWTLAFYDDLDRIAAERILHRFVNRVRSAVAEAYKAGPFRYQSPRDTAKKIAESIT
VEELERAVVENQPRFDRSFAPVIMEILRAKLKSPMYLQHGGRLIMALAPLPDEERDAVLR
AIFSPREEVERLVKEGKLKPYALELYDYVHDAR
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgatagaggtagattcttctgttcttcgcgaatacggcgatttgtttggcgaaaaactg
gtaaacggccggagggtatctgtggaggggcttatagaggagttgacgagagagctcagg
gcggagatagatcgggtaattagagctagacgggagtggctaaacgatagacgacctgta
agaaccaaggccgcatttcctcaatgggatgaaaaattcacagacgcagacggcaatgtg
aagacctttaaggaaatcgttcagggtcttatagataatttcctaggccgcgagacgccg
ttgaggtgggggctcaactggaatgtgccagttcccgacgacctccacccgcttaagaac
cccggcctggagataacggggccgtggtatcccatgaatagggcgatacaccagataaac
gcggacgtggcgtctatgatggaggacgaggaggacgcctcccccgcctggttcattccc
cgtggctccgggcgcaccacggctgcggtgtgggaggcccggcggattgtgaacaaggtg
cttagaggcgacgtgccacagccctactacgaggggggcaaggagtacaggataaagaag
ccgagggagaagtggcctacgctcattcacagagtgccgggcctccacatcttggatttc
gatattagggttgacggaaagccggccccggcaataataacctcggtagtaatctacaca
gtcaataactacgaccttttgaagaaggcgggctccggtgtctacttctatgtgcctaaa
gtccagacaccagacgaggcgttggtgattgagaaaatactgcggaaggttgaggacaag
cttggactgaggcggggtgagctcaaaatcgcgatgctctacgaggaggcgagagccggc
ctgtatctcccggttattttctggatatggcgcgagaggctagtgaagagcaacaacggc
cgctgggactatcttggctctctcatcgagatgtggaaggacgaggcggtttatcctgat
ccgcaaaacatcacgatgacccaccccgtcatgatggcgtatcagaagtggaacgcgctc
atgtgcctaatggcggggctggacagagagggcaggctaaacgccggccccgtgggcggc
atggcggcggtcatgctctacagagcggacgacccgtaccagcgccaccgcttcaaccaa
agggcgctgagggcgatttggctggataagctcagagaaaggctcataggcctcatcttc
gttacagaagagcccgtgaagaaagtcactctaagagaggtgctggagggcaaggtcaag
gggaggcttttcgacctatttaggcagagctgggtggcgacgccggaggagtcgtatgta
aaagcaggcaacgagcctttgcgtgcgagcttggaggagctccagcagatgataaaccgc
ccagtcaagttcgtggaggtggacggcgtgaagataccgaccgtggatagcggattgaca
gagcaggaaaggcaactcttcataaggctcggcctcttagacgaacagggcaacataacc
ccctgggtgataagacccgacatgctggacacgccggagaagctcctgggcaaccccgag
ctgtggggaggcaaggacttgtggacggcgctcttcgagccgcccaagggcgacatcacg
gctgagcatatccaacacgcattctacatggccgctaactacggcttccagctcctaaac
ggcaacctcgcggcggctatcgacgactacgagctggggcaacgcttcatgaacgacttg
gccacctaccgcatattctcgacgtggctgtggaccttgctgagacacaacgcggtcatc
acgaaagacggggcctttaagggtccagcgcgcacaggccttggagtaatccccgctgag
gatagggtgaaggtggcggcgggcacgcgcttcacggaggagctctttgacaagttgtgg
gatctccacatggagtggactctcgccttctacgacgacttagaccgcatcgcggccgag
aggatcctccacagattcgtgaatagggtgaggagcgcggtcgccgaggcttacaaggcc
ggcccgttcaggtaccagtcgccgcgagacaccgctaagaagatcgccgagtccataacg
gtggaggagctggagagggctgtggtggagaaccagccgaggttcgacaggtccttcgcc
cctgtcataatggagattctgagggcgaagctgaagtcgcctatgtatctacaacacggc
ggccgcttaatcatggccttggcgcctctgcccgacgaggagagagacgccgtattaagg
gccattttctcgcctagggaggaggtggagaggctagtgaaggagggcaagctgaagccc
tacgcccttgagctctacgactacgttcacgatgctagataa

DBGET integrated database retrieval system