KEGG   Pyrobaculum oguniense: Pogu_1860Help
Entry
Pogu_1860         CDS       T01735                                 

Definition
(RefSeq) Malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
pog  Pyrobaculum oguniense
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pogu_1860
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pogu_1860
   00630 Glyoxylate and dicarboxylate metabolism
    Pogu_1860
Enzymes [BR:pog01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Pogu_1860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1618232..1620673
Genome map
AA seq 813 aa AA seqDB search
MIEVDSSVLREYGDLFGEKLVNGRRVSVEGLIEELTRELRAEIDRVIRARREWLNDRRPV
RTKAAFPQWDEKFTDADGNVKTFKEIVQGLIDNFLGRETPLRWGLNWNVPVPDDLHPLKN
PGLEITGPWYPMNRAIHQINADVASMMEDEEDASPAWFIPRGSGRTTAAVWEARRIVNKV
LRGDVPQPYYEGGKEYRIKKPREKWPTLIHRVPGLHILDFDIRVDGKPAPAIITSVVIYT
VNNYDLLKKAGSGVYFYVPKVQTPDEALVIEKILRKVEDKLGLRRGELKIAMLYEEARAG
LYLPVIFWIWRERLVKSNNGRWDYLGSLIEMWKDEAVYPDPQNITMTHPVMMAYQKWNAL
MCLMAGLDREGRLNAGPVGGMAAVMLYRADDPYQRHRFNQRALRAIWLDKLRERLIGLIF
VTEEPVKKVTLREVLEGKVKGRLFDLFRQSWVATPEESYVKAGNEPLRASLEELQQMINR
PVKFVEVDGVKIPTVDSGLTEQERQLFIRLGLLDEQGNITPWVIRPDMLDTPEKLLGNPE
LWGGKDLWTALFEPPKGDITAEHIQHAFYMAANYGFQLLNGNLAAAIDDYELGQRFMNDL
ATYRIFSTWLWTLLRHNAVITKDGAFKGPARTGLGVIPAEDRVKVAAGTRFTEELFDKLW
DLHMEWTLAFYDDLDRIAAERILHRFVNRVRSAVAEAYKAGPFRYQSPRDTAKKIAESIT
VEELERAVVENQPRFDRSFAPVIMEILRAKLKSPMYLQHGGRLIMALAPLPDEERDAVLR
AIFSPREEVERLVKEGKLKPYALELYDYVHDAR
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgatagaggtagattcttctgttcttcgcgaatacggcgatttgtttggcgaaaaactg
gtaaacggccggagggtatctgtggaggggcttatagaggagttgacgagagagctcagg
gcggagatagatcgggtaattagagctagacgggagtggctaaacgatagacgacctgta
agaaccaaggccgcatttcctcaatgggatgaaaaattcacagacgcagacggcaatgtg
aagacctttaaggaaatcgttcagggtcttatagataatttcctaggccgcgagacgccg
ttgaggtgggggctcaactggaatgtgccagttcccgacgacctccacccgcttaagaac
cccggcctggagataacggggccgtggtatcccatgaatagggcgatacaccagataaac
gcggacgtggcgtctatgatggaggacgaggaggacgcctcccccgcctggttcattccc
cgtggctccgggcgcaccacggctgcggtgtgggaggcccggcggattgtgaacaaggtg
cttagaggcgacgtgccacagccctactacgaggggggcaaggagtacaggataaagaag
ccgagggagaagtggcctacgctcattcacagagtgccgggcctccacatcttggatttc
gatattagggttgacggaaagccggccccggcaataataacctcggtagtaatctacaca
gtcaataactacgaccttttgaagaaggcgggctccggtgtctacttctatgtgcctaaa
gtccagacaccagacgaggcgttggtgattgagaaaatactgcggaaggttgaggacaag
cttggactgaggcggggtgagctcaaaatcgcgatgctctacgaggaggcgagagccggc
ctgtatctcccggttattttctggatatggcgcgagaggctagtgaagagcaacaacggc
cgctgggactatcttggctctctcatcgagatgtggaaggacgaggcggtttatcctgat
ccgcaaaacatcacgatgacccaccccgtcatgatggcgtatcagaagtggaacgcgctc
atgtgcctaatggcggggctggacagagagggcaggctaaacgccggccccgtgggcggc
atggcggcggtcatgctctacagagcggacgacccgtaccagcgccaccgcttcaaccaa
agggcgctgagggcgatttggctggataagctcagagaaaggctcataggcctcatcttc
gttacagaagagcccgtgaagaaagtcactctaagagaggtgctggagggcaaggtcaag
gggaggcttttcgacctatttaggcagagctgggtggcgacgccggaggagtcgtatgta
aaagcaggcaacgagcctttgcgtgcgagcttggaggagctccagcagatgataaaccgc
ccagtcaagttcgtggaggtggacggcgtgaagataccgaccgtggatagcggattgaca
gagcaggaaaggcaactcttcataaggctcggcctcttagacgaacagggcaacataacc
ccctgggtgataagacccgacatgctggacacgccggagaagctcctgggcaaccccgag
ctgtggggaggcaaggacttgtggacggcgctcttcgagccgcccaagggcgacatcacg
gctgagcatatccaacacgcattctacatggccgctaactacggcttccagctcctaaac
ggcaacctcgcggcggctatcgacgactacgagctggggcaacgcttcatgaacgacttg
gccacctaccgcatattctcgacgtggctgtggaccttgctgagacacaacgcggtcatc
acgaaagacggggcctttaagggtccagcgcgcacaggccttggagtaatccccgctgag
gatagggtgaaggtggcggcgggcacgcgcttcacggaggagctctttgacaagttgtgg
gatctccacatggagtggactctcgccttctacgacgacttagaccgcatcgcggccgag
aggatcctccacagattcgtgaatagggtgaggagcgcggtcgccgaggcttacaaggcc
ggcccgttcaggtaccagtcgccgcgagacaccgctaagaagatcgccgagtccataacg
gtggaggagctggagagggctgtggtggagaaccagccgaggttcgacaggtccttcgcc
cctgtcataatggagattctgagggcgaagctgaagtcgcctatgtatctacaacacggc
ggccgcttaatcatggccttggcgcctctgcccgacgaggagagagacgccgtattaagg
gccattttctcgcctagggaggaggtggagaggctagtgaaggagggcaagctgaagccc
tacgcccttgagctctacgactacgttcacgatgctagataa

DBGET integrated database retrieval system