KEGG   Pyrobaculum oguniense: Pogu_1911Help
Entry
Pogu_1911         CDS       T01735                                 

Definition
Cellulase M-related protein (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pog  Pyrobaculum oguniense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pogu_1911
Enzymes [BR:pog01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Pogu_1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1660615..1661529
Genome map
AA seq 304 aa AA seqDB search
MVAAHIDEIGLVVDHIEKEGYLRFRPIGGWNEVILVSQRVWVRTSDGRWIRGVVGSLPPH
VTPSGKEREAPEIKDLFIDIGVSSREEAEKLGVTVGSVAVLDREFAVFNGKVVTGKAFDD
RLGVAVMLYALRMLEKLPVTLYAVATVQEEVRLRGASVAAERINPHYAIALGTTIAADVP
GVWERLHVTKLGKGPAIKVLDGGGGGLFIAHPGLRDHTVKLARELGIPYQMEVLYGGTTD
AMAIAFRREGVPAAVISVPTRYIHYPVEVLDVEDAVNAAKLLKATRKELRRRLWRSFLTR
ELSS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggcgcacatcgacgagatcggactcgtcgtggaccacatagagaaggagggc
tacctgagattcagaccaattggagggtggaatgaggttattctcgtcagccagcgggtc
tgggtgaggacttcagatggccggtggataagaggggttgtggggtctctgccgccgcat
gtaacgccaagcgggaaggagcgcgaggcgcctgagattaaggacttgtttatagacatc
ggcgtgtctagcagagaggaggcggagaagctaggcgtcaccgtcggatctgtggctgta
ctggatagggaattcgccgtgtttaacggaaaggtggtcaccgggaaggcgtttgacgac
aggttgggagtagccgtgatgctctacgccttgaggatgctggaaaaactacctgtcacc
ctctacgccgtggcgacagtccaggaggaggttagactccgcggggcaagcgtcgctgca
gagcgaattaatccccactacgctattgccctgggcaccaccattgccgccgacgtaccg
ggcgtctgggagaggcttcacgtaacgaagttgggcaagggcccggccataaaggtgctg
gacggcggtgggggtggcctattcatagcccacccaggcctgagggatcacaccgtgaag
ttggcgagggagctcgggatcccctaccagatggaggtgctttacggcggtaccaccgac
gccatggccatagcctttaggagggagggcgtccccgccgctgttatctcggtgcctacg
cggtatatccactacccggtggaggtcctcgacgtggaggacgccgtaaacgcggctaag
ttgcttaaggcaactcggaaagaactacgccggagattgtggagaagtttcttgacaaga
gagttaagtagctag

DBGET integrated database retrieval system