KEGG   Pyrobaculum oguniense: Pogu_2006Help
Entry
Pogu_2006         CDS       T01735                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pog  Pyrobaculum oguniense
Pathway
pog00010  Glycolysis / Gluconeogenesis
pog00071  Fatty acid degradation
pog00350  Tyrosine metabolism
pog00625  Chloroalkane and chloroalkene degradation
pog00626  Naphthalene degradation
pog01100  Metabolic pathways
pog01110  Biosynthesis of secondary metabolites
pog01120  Microbial metabolism in diverse environments
pog01130  Biosynthesis of antibiotics
pog01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pogu_2006
  Lipid metabolism
   00071 Fatty acid degradation
    Pogu_2006
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pogu_2006
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pogu_2006
   00626 Naphthalene degradation
    Pogu_2006
Enzymes [BR:pog01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pogu_2006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C Glu_dehyd_C Sacchrp_dh_NADP XdhC_C TrkA_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AFA40033
UniProt: H6QB36
Position
complement(1742632..1743690)
Genome map
AA seq 352 aa AA seqDB search
MKIPVKIKAAVYKSPGQPLELSEIPTPTPGEGEVLIKVAATGVCHSDLHVLDGEMIPSPE
GFILGHEVSGWVVEFGPRCENPHGLSPGDPVVVSWIIPCGKCYWCVRGQENYCPYAAARM
PGLVGINGGHAEYMTVPETAIYTIPKGLDVHNAAVISCAYGTAYRALKEAGVAPGTSLVV
VGAGGVGLAAVELAVALGAYPIVAVDVREAALSKAQEVGASHVINAAERDAIGAIREALP
QGADVVYETKPNPDLKIALEVVRRGGSIVVTGLGASTIEIPAMHLVMNGIRIVGSLGYKP
RTDIPELLALAATGKIKPEKIISHRYKPENINEAYNNLRQGKHHRALVVWNP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtgaagattcccgtcaaaataaaagcggctgtatacaaatcacccggccagccgcttgag
ctctccgagataccgaccccaactccgggtgaaggcgaggtgttgataaaagtcgcagca
acaggggtatgccactccgacctacatgtactagacggcgagatgatcccctcgccagag
ggcttcatactaggacacgaggtatcggggtgggtagttgagtttgggccgaggtgcgaa
aacccccacggcctctccccaggcgaccccgttgttgtctcttggatcataccatgcggc
aagtgctactggtgcgtcagaggacaggaaaactactgcccatacgccgccgcgaggatg
ccaggccttgttgggatcaacgggggacacgcggagtacatgacagtgcccgagacggcg
atatacacaataccgaaaggactcgacgtacacaacgccgcggtcatctcgtgcgcctac
ggcactgcatacagagccttgaaagaagccggcgtggcccccggcacttcgcttgtggtt
gtaggcgccggaggcgtggggttggcggcggttgagcttgcggttgcacttggagcctac
cccattgtagctgtagacgtgagagaggctgcgctgagtaaagcccaggaggtcggcgcc
agccatgtgataaacgccgccgagagagacgcaatcggggccataagagaagcgttgccc
caaggcgctgacgtggtctacgagacgaagccaaacccagatctcaaaattgccctagaa
gttgttagaagaggggggtcaatagtagtcacgggcctcggcgcgtcaacaattgagata
ccggcaatgcacctcgtaatgaatggaataagaattgtggggagcctaggctacaagcca
cgcactgacataccagaactcctagccctagccgccacagggaagataaagcctgaaaaa
ataatctcacataggtataagccggaaaacatcaacgaggcctacaacaacctacgacaa
ggaaaacaccaccgtgcattagttgtctggaatccttaa

DBGET integrated database retrieval system