KEGG   Pyrobaculum oguniense: Pogu_2273Help
Entry
Pogu_2273         CDS       T01735                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pog  Pyrobaculum oguniense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pogu_2273
Enzymes [BR:pog01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Pogu_2273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1974327..1975739)
Genome map
AA seq 470 aa AA seqDB search
MLRGAGVLLHITSLPGGCYVGDLGPEAYKFAEFLAEAEQTYWQTLPINHSVPEYENSPYS
AVSSFAGDPKLISLDLMKREGLIDQVPDCPTAERADYAAAWEVKKKALEKALRRGKKLSD
YKNFAESTPWLEDYAYYMAMRDLYGPWPKWPRKEPPGELVELYKFAQFVFWRQWRELKQY
VNSLGIFLIGDLPIYPSLDSADVWRHRRYFKITEDGAPLYVAGVPPDYFSPTGQLWGNPV
YNWDALRADGYRWWLDRLRHALSVFDYVRLDHFRGYAAYWEVPAGEKTAVRGRWVPAPGA
ELLEKARAELGELRLIAEDLGYITPDVVELRDRFGLPGMRVLQFAWDGNPANEHKPHNHV
KNSVVYTGTHDNNMAVGWYQEEATPRARREFREYAKCASGEGVNWCFIRLAHMSVADVAI
VPMQDVLGLGSEARMNKPGTMGGNWRWRLAKMPDAAVLRRLRKLTRTYGR
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgctacggggggcaggcgtcctactccacataacttccctcccaggcggttgctacgtg
ggcgatctaggcccggaggcgtataaattcgccgagtttttagcagaggcggagcagacc
tactggcagacgctacctattaaccacagcgtgccggagtacgagaactccccctacagc
gcggtgtcgagcttcgcaggggatcccaaactgataagcctagacctcatgaagagggag
ggcctcatagaccaagtgccggattgtcccactgccgagagggccgactacgccgcggcg
tgggaggtgaagaaaaaggcactggaaaaggcgctgaggagggggaagaagctcagcgac
tacaagaacttcgcggaatccaccccctggcttgaggactacgcatactacatggccatg
agggacctctacgggccctggccgaagtggccgaggaaagagccgccgggggagctagtg
gagctttacaaattcgcccagttcgtcttctggcgccagtggcgagagctcaagcagtat
gtaaacagccttggcatcttcctcataggggacctccccatataccccagcctagacagc
gccgacgtgtggaggcacaggcggtacttcaaaatcacagaggacggcgcccctctctac
gtggccggcgtcccgccggactacttctcgccgactggccagctctgggggaaccccgtg
tacaactgggacgcattgagggccgacgggtaccgatggtggctagaccggctgaggcac
gcgctgtccgtgttcgactacgttaggctggaccacttccgcggatacgcggcctactgg
gaggtccccgccggcgagaagacggcggtgagagggcggtgggtccccgcgcctggggca
gagctgttggaaaaagccagggcggagctgggggagcttaggctaatcgcagaggacctc
ggctacataaccccagacgtggtggagctgagagaccgcttcggcctccccggcatgcgc
gtcttgcagttcgcctgggacggcaaccccgcaaacgagcacaagccgcacaaccacgtc
aaaaactccgtggtgtacaccggcacccacgacaacaacatggcggtggggtggtatcaa
gaagaggcgacgccgagggctaggcgcgagttccgggaatacgccaagtgcgccagcgga
gagggcgtgaactggtgcttcattaggctggcccacatgtctgtagccgacgtggccatc
gtgcctatgcaagacgtgctggggctcggcagcgaggcgcgtatgaacaagccaggcaca
atggggggcaactggaggtggaggctggcaaaaatgccagacgccgccgtgttgaggcgg
ttgagaaaactaacacgtacatacgggcggtga

DBGET integrated database retrieval system