KEGG   Pyrobaculum oguniense: Pogu_2286Help
Entry
Pogu_2286         CDS       T01735                                 

Definition
2-oxoacid:acceptor oxidoreductase subunit delta, pyruvate/2-ketoisovalerate family (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
pog  Pyrobaculum oguniense
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pogu_2286
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pogu_2286
   00020 Citrate cycle (TCA cycle)
    Pogu_2286
   00620 Pyruvate metabolism
    Pogu_2286
   00640 Propanoate metabolism
    Pogu_2286
   00650 Butanoate metabolism
    Pogu_2286
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pogu_2286
   00680 Methane metabolism
    Pogu_2286
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pogu_2286
Enzymes [BR:pog01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pogu_2286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1987252..1987557)
Genome map
AA seq 101 aa AA seqDB search
MTLPTATELPIGAVVTEPGSTRRNITAGWRALRPVIHDDRCVRCQLCWMYCPEGTIVELK
GVFKVGNRTYDTKYEINYDYCKGCGICANECPTKAIEMVPE
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgaccctccccacggcaacagagctaccgatcggcgccgtagtgacggagccggggtcg
acacgccgcaacatcaccgccggctggagggccctccggcccgttatacacgacgacagg
tgcgtaaggtgccagctctgctggatgtattgtccagagggcaccatcgtcgagttgaag
ggcgtattcaaagtgggcaacaggacatacgacacgaaatacgagataaactatgactac
tgcaaaggctgcggcatctgtgcaaacgagtgccccacgaaagcgatagaaatggtgccc
gagtag

DBGET integrated database retrieval system