KEGG   Pyrobaculum oguniense: Pogu_2290Help
Entry
Pogu_2290         CDS       T01735                                 

Definition
Aldehyde:ferredoxin oxidoreductase (EC:1.2.7.6)
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
pog  Pyrobaculum oguniense
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pogu_2290
   01230 Biosynthesis of amino acids
    Pogu_2290
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pogu_2290
Enzymes [BR:pog01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     Pogu_2290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1990224..1992074)
Genome map
AA seq 616 aa AA seqDB search
MILLEIDVGKNKVEKQEIDASGPLEAAITIHKKYETWRLDPLSPEAPIVFGMGPFVGGKL
YGVHRLIFVFKSPQTKTLHVSALGGAAYKAMGMGAQAVAIRGRAEKPAAVFIANGQVEFA
EVKPSDAYNLIKELYETRRDFFIQNDARALVVGPASWTTYNGAIVSVDIDVKKGEFRMGA
EDFAARGGPGTALAQGHNVVAIVVGGPKKPLYEKVADAEAINQLFRQRLGKPYLDVLNEK
TVKYRYDPKIGTGGTFGVNYPHYRDLLPLFGYKSIYMPKEERIKHADLVLELFWKPFQVE
VFEKAKSWYNCGEPCPVVCKKVWRGKKVDYESFHAAGPFIGNYLFQEAVPVIDEIDKLGL
DAIEMGHVVAWLFDAIYTGLLKPEEVGLDDVPAFDPSSFDPVKDSRRNARLALMLVRNFV
NNSTDVLSLVAKHGIRKAARELERRYADRVRERGVRFRDLAVYAAYGAEGYMTPNFYWAP
GLVAPMYVLGRYWTNYNPTFMSPEDFAKTSYERAVAEALVDNAGICRFHRGWAEPVLKEL
YQLVGARPPAALYREIAYYAKLSGAEPMPWESKRTRDLVSALAKELGSKEWRFEDYDDYY
EWWVRFKEALDKLILA
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
gtgatactacttgaaatagacgtagggaagaacaaagttgagaaacaagaaatagacgcc
tcggggccgctggaagccgctattacgatccacaaaaaatacgagacgtggcgccttgat
ccgctatccccagaagcccccatagtcttcggcatgggccccttcgtcggtgggaagctc
tacggcgtccaccgcctcatctttgtcttcaaaagcccgcagacaaagaccctacacgtg
tcggccctaggcggagccgcatacaaggcaatgggcatgggcgcccaggcggtggccata
agagggagggccgagaagcccgccgctgtttttattgcaaacggccaagtggaattcgcc
gaggttaagccaagcgacgcctacaacctgatcaaagagctctacgagacacgcagagat
ttcttcatacaaaacgacgcaagagccctcgtggtgggcccagcctcgtggacgacgtac
aacggagccattgtttctgtagatatagacgtaaagaaaggggagtttcggatgggagcg
gaggacttcgccgccaggggaggccccggcacggcgctggcccaaggccacaacgtcgta
gccatcgtggtaggcggccccaagaagccgctttacgaaaaagtggcagacgcagaggcg
ataaaccagctttttaggcagaggctcgggaagccctacctagacgtgcttaacgaaaag
accgtgaagtacagatacgaccccaagatagggacagggggcacctttggcgtcaactac
ccccactaccgcgacttgctccccctcttcggctacaagtcgatatacatgccgaaggag
gagagaataaaacacgccgacctcgtcctagagctgttctggaagcccttccaagtcgag
gttttcgaaaaggcaaaaagctggtacaactgcggcgagccttgccccgtggtgtgcaaa
aaggtgtggagggggaaaaaggtcgattatgaatcatttcacgccgcagggcccttcata
ggcaactacctattccaagaggccgtgccggttatagacgagattgacaagctgggccta
gacgccatagagatgggccacgtcgtcgcctggctgttcgacgccatttacacgggtctg
cttaaaccggaggaggtgggtctcgacgacgtgccggccttcgacccgtccagcttcgac
ccggttaaggactcaaggagaaacgccaggctcgccctaatgttggtgaggaacttcgta
aacaactccaccgacgtcttgtcgcttgtggccaaacacggcattaggaaggcggcgcgg
gagctggagaggcgctatgcggacagggtaagggagaggggagtacggttcagggactta
gccgtatacgccgcatacggcgccgaggggtacatgacccccaacttctactgggcaccc
gggctagtcgcccccatgtacgtgctgggcaggtactggacgaactacaaccccaccttc
atgtcccccgaggacttcgccaagacctcctacgagagggcggtggccgaggcgctggtg
gacaacgccggaatttgccgattccaccggggctgggcagagcccgtgctcaaagagctg
taccagcttgtcggcgcccggccccccgccgcgctctaccgtgaaattgcctactacgca
aagctctcaggcgcagagcctatgccatgggagtccaagaggacgcgggacttagtctcc
gccctggccaaggagctgggaagcaaggagtggaggttcgaagactacgacgactattat
gagtggtgggtaaggttcaaagaagcactggacaagttaatacttgcctag

DBGET integrated database retrieval system