KEGG   Pyrobaculum oguniense: Pogu_2317Help
Entry
Pogu_2317         CDS       T01735                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pog  Pyrobaculum oguniense
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pog01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pog00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2009893..2011002
Genome map
AA seq 369 aa AA seqDB search
MRKGFPRDVLEAAGKIIDDVRDGGLGAALKYSERLDGEAPREVLIAPRPGGDPGVVGAAL
EAVRSLEALYRKLAPPSAVDYYGGVLRTVVWKPVRRTALYVPARYVSTLVMLAVPAKAAG
VEELYVVTPPRGVTGEVLAVAKELGIKAVLALGGAHGLAYAAFHLGVDMLAGPGGLYVQA
AKFLLSQYVGIDGIEGPTELVVYAEGVPPETAARGALAQLEHGPTSFAYVLSTDASLLKG
VEEVYKREKTSSMGPLETRLVSSVEEAVEFIDAVAPEHLEVWGRRDIAYRVRNVGAVSVN
MPSPYLDYVAGISHVLPTGGTARWRGIITPLTFMKAVGIAEAVGEIKLAEAARRLAQYEG
FQFHYRALL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagggcttccctcgcgacgtgcttgaggccgccggcaagataattgacgatgtc
agagacggcgggctaggcgccgctcttaaatactccgagaggctcgacggcgaggcgccg
agggaggtcctaatcgcgccgcggcctgggggcgaccccggcgtggtgggggcggcgctg
gaggcggtccgctcccttgaggcgctttacaggaagctggcgccgcccagcgctgtggac
tactacggcggcgtcctcagaacggtggtgtggaagccggtgaggaggacggcgctatac
gtcccggcgcgctatgtctccaccttggtgatgctggccgtgccggcgaaggcggcgggt
gtcgaggagctgtacgtggttactccccccaggggggttacgggggaggtcctcgcagtg
gcgaaggagctggggatcaaggcggttttggcgctgggaggggcccacggccttgcatac
gccgccttccacctcggcgtggacatgctggcgggccctgggggtctctacgtccaggcc
gccaagttcctcctctcccagtacgtggggattgacgggattgaggggccgacggagctt
gtggtatatgcagagggggtgcctcccgagacggcggcgcgcggcgccttagcccagctg
gaacacggcccgacctcctttgcctacgtcctatccaccgacgcctccctcctaaaaggc
gtcgaggaggtgtacaagagggagaagacctcgtctatgggccccctagagacgcggctg
gtgtcaagcgtggaggaggctgtggagttcattgacgctgtggcgccggagcacttggag
gtctggggccggcgggacatcgcgtatagggttaggaacgtgggggcggtgtcggtgaat
atgccctccccctacctcgactacgtggccggcattagccacgtcttgcccacaggcggc
actgcgaggtggcgtggcataatcacgccgctgaccttcatgaaggctgtcggcatcgcc
gaggccgtcggcgaaattaagctggccgaggcggctaggaggctggcgcagtacgagggc
ttccagttccactacagagcgttgttatga

DBGET integrated database retrieval system