KEGG   Pyrobaculum oguniense: Pogu_2343Help
Entry
Pogu_2343         CDS       T01735                                 

Definition
fructose 1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
pog  Pyrobaculum oguniense
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:pog01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pog01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pog00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pog00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pog00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:pog00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2032468..2033667
Genome map
AA seq 399 aa AA seqDB search
MKVTVSIIKADVGGFPGHAHVHPKMLEYAAAKLKEAQKRGAIIDYFVYNVGDDISLLMTH
TKGEDNPEIHGLAWETFKEITEQIAKKFKLYGAGQDLLKDAFSGNVRGMGPQVAEMEFEE
RPSDPLIVFAADKTEPGAFNLPLYKMFADPFNTAGLVIDPSMHEGFIFEVLDVVEHKVYL
LKTPEEAYSLLGLIGTTGRYIIRKVFRKADGAPAATNSVERLSLIAGRYVGKDDPVMMVR
AQSGLPAVGEILEAFAHPHLVHGWMRGSHAGPLMPARFISIDPERRIAIGAKMTRFDGPP
KVGALGFQLHDGYLEGGVDLFDDPAFDYVRQVAAQIADYIRRMGPFQPHRLPPEEMEYTA
LPKILAKIKAYPADKYEKERRKYIEAIVKGEKVEESQHD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaccgtatcaataatcaaggccgacgtcggcggcttcccgggacatgcccac
gtccatccaaaaatgcttgaatacgccgcggcgaagctaaaagaggcgcaaaagaggggg
gccataatcgactactttgtctacaacgtcggcgacgacatatcgctactcatgactcac
acaaaaggcgaggacaaccccgagatacacggcctcgcctgggagactttcaaggagatc
acagagcaaatagcgaagaagtttaagctctacggggctggtcaagacttgttgaaagac
gccttctccggcaacgtaagaggaatggggccgcaagtcgcagaaatggagtttgaagaa
aggccgagcgacccgttaattgtatttgcagcagacaagacagagcccggcgcattcaac
ctcccgctgtataagatgttcgcagacccgttcaacacggcggggctcgtaatagatccg
tcaatgcacgaaggctttatcttcgaagttctagacgtagtggagcacaaggtctaccta
ttaaagacgccagaggaggcctactcgttgctgggcttaataggcaccactgggaggtat
attattaggaaagtcttcagaaaagccgatggtgcgccggccgctacaaatagcgtcgaa
aggctctctctaattgccgggagatatgtcggcaaagacgacccagtgatgatggttaga
gcccagtcggggctccccgctgttggagaaattcttgaggccttcgcacatccacacctc
gtccacgggtggatgcgcggctcgcacgcaggtccgcttatgccagcgcgcttcatttcc
atagatcccgaaaggagaattgccataggcgccaaaatgacccgcttcgacggaccgccc
aaagtcggcgccctaggcttccagctacacgacggatacttagaaggcggcgttgaccta
ttcgatgacccggcctttgactacgttaggcaagtcgcggcccaaatagcagattacata
cgcagaatggggcccttccagccacaccgcctcccgccagaagagatggaatacacagcc
ctgcctaaaatcttggcaaaaattaaggcctaccccgccgacaagtacgaaaaagagagg
aggaaatacatcgaagcaatagtaaaaggagaaaaagtagaggagtctcaacacgactaa

DBGET integrated database retrieval system