KEGG   Pyrobaculum oguniense: Pogu_2343Help
Entry
Pogu_2343         CDS       T01735                                 

Definition
(GenBank) Archaeal fructose 1,6-bisphosphatase
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
pog  Pyrobaculum oguniense
Pathway
pog00010  Glycolysis / Gluconeogenesis
pog00030  Pentose phosphate pathway
pog00051  Fructose and mannose metabolism
pog00680  Methane metabolism
pog01100  Metabolic pathways
pog01110  Biosynthesis of secondary metabolites
pog01120  Microbial metabolism in diverse environments
pog01130  Biosynthesis of antibiotics
pog01200  Carbon metabolism
pog01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pogu_2343
   00030 Pentose phosphate pathway
    Pogu_2343
   00051 Fructose and mannose metabolism
    Pogu_2343
  Energy metabolism
   00680 Methane metabolism
    Pogu_2343
Enzymes [BR:pog01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Pogu_2343
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Pogu_2343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AFA40370
UniProt: H6QBL9
Position
2032468..2033667
Genome map
AA seq 399 aa AA seqDB search
MKVTVSIIKADVGGFPGHAHVHPKMLEYAAAKLKEAQKRGAIIDYFVYNVGDDISLLMTH
TKGEDNPEIHGLAWETFKEITEQIAKKFKLYGAGQDLLKDAFSGNVRGMGPQVAEMEFEE
RPSDPLIVFAADKTEPGAFNLPLYKMFADPFNTAGLVIDPSMHEGFIFEVLDVVEHKVYL
LKTPEEAYSLLGLIGTTGRYIIRKVFRKADGAPAATNSVERLSLIAGRYVGKDDPVMMVR
AQSGLPAVGEILEAFAHPHLVHGWMRGSHAGPLMPARFISIDPERRIAIGAKMTRFDGPP
KVGALGFQLHDGYLEGGVDLFDDPAFDYVRQVAAQIADYIRRMGPFQPHRLPPEEMEYTA
LPKILAKIKAYPADKYEKERRKYIEAIVKGEKVEESQHD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaccgtatcaataatcaaggccgacgtcggcggcttcccgggacatgcccac
gtccatccaaaaatgcttgaatacgccgcggcgaagctaaaagaggcgcaaaagaggggg
gccataatcgactactttgtctacaacgtcggcgacgacatatcgctactcatgactcac
acaaaaggcgaggacaaccccgagatacacggcctcgcctgggagactttcaaggagatc
acagagcaaatagcgaagaagtttaagctctacggggctggtcaagacttgttgaaagac
gccttctccggcaacgtaagaggaatggggccgcaagtcgcagaaatggagtttgaagaa
aggccgagcgacccgttaattgtatttgcagcagacaagacagagcccggcgcattcaac
ctcccgctgtataagatgttcgcagacccgttcaacacggcggggctcgtaatagatccg
tcaatgcacgaaggctttatcttcgaagttctagacgtagtggagcacaaggtctaccta
ttaaagacgccagaggaggcctactcgttgctgggcttaataggcaccactgggaggtat
attattaggaaagtcttcagaaaagccgatggtgcgccggccgctacaaatagcgtcgaa
aggctctctctaattgccgggagatatgtcggcaaagacgacccagtgatgatggttaga
gcccagtcggggctccccgctgttggagaaattcttgaggccttcgcacatccacacctc
gtccacgggtggatgcgcggctcgcacgcaggtccgcttatgccagcgcgcttcatttcc
atagatcccgaaaggagaattgccataggcgccaaaatgacccgcttcgacggaccgccc
aaagtcggcgccctaggcttccagctacacgacggatacttagaaggcggcgttgaccta
ttcgatgacccggcctttgactacgttaggcaagtcgcggcccaaatagcagattacata
cgcagaatggggcccttccagccacaccgcctcccgccagaagagatggaatacacagcc
ctgcctaaaatcttggcaaaaattaaggcctaccccgccgacaagtacgaaaaagagagg
aggaaatacatcgaagcaatagtaaaaggagaaaaagtagaggagtctcaacacgactaa

DBGET integrated database retrieval system