KEGG   Pyrobaculum oguniense: Pogu_2343Help
Entry
Pogu_2343         CDS       T01735                                 

Definition
fructose 1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
pog  Pyrobaculum oguniense
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pogu_2343
   01230 Biosynthesis of amino acids
    Pogu_2343
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pogu_2343
   00030 Pentose phosphate pathway
    Pogu_2343
   00051 Fructose and mannose metabolism
    Pogu_2343
  Energy metabolism
   00680 Methane metabolism
    Pogu_2343
Enzymes [BR:pog01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Pogu_2343
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Pogu_2343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2032468..2033667
Genome map
AA seq 399 aa AA seqDB search
MKVTVSIIKADVGGFPGHAHVHPKMLEYAAAKLKEAQKRGAIIDYFVYNVGDDISLLMTH
TKGEDNPEIHGLAWETFKEITEQIAKKFKLYGAGQDLLKDAFSGNVRGMGPQVAEMEFEE
RPSDPLIVFAADKTEPGAFNLPLYKMFADPFNTAGLVIDPSMHEGFIFEVLDVVEHKVYL
LKTPEEAYSLLGLIGTTGRYIIRKVFRKADGAPAATNSVERLSLIAGRYVGKDDPVMMVR
AQSGLPAVGEILEAFAHPHLVHGWMRGSHAGPLMPARFISIDPERRIAIGAKMTRFDGPP
KVGALGFQLHDGYLEGGVDLFDDPAFDYVRQVAAQIADYIRRMGPFQPHRLPPEEMEYTA
LPKILAKIKAYPADKYEKERRKYIEAIVKGEKVEESQHD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaccgtatcaataatcaaggccgacgtcggcggcttcccgggacatgcccac
gtccatccaaaaatgcttgaatacgccgcggcgaagctaaaagaggcgcaaaagaggggg
gccataatcgactactttgtctacaacgtcggcgacgacatatcgctactcatgactcac
acaaaaggcgaggacaaccccgagatacacggcctcgcctgggagactttcaaggagatc
acagagcaaatagcgaagaagtttaagctctacggggctggtcaagacttgttgaaagac
gccttctccggcaacgtaagaggaatggggccgcaagtcgcagaaatggagtttgaagaa
aggccgagcgacccgttaattgtatttgcagcagacaagacagagcccggcgcattcaac
ctcccgctgtataagatgttcgcagacccgttcaacacggcggggctcgtaatagatccg
tcaatgcacgaaggctttatcttcgaagttctagacgtagtggagcacaaggtctaccta
ttaaagacgccagaggaggcctactcgttgctgggcttaataggcaccactgggaggtat
attattaggaaagtcttcagaaaagccgatggtgcgccggccgctacaaatagcgtcgaa
aggctctctctaattgccgggagatatgtcggcaaagacgacccagtgatgatggttaga
gcccagtcggggctccccgctgttggagaaattcttgaggccttcgcacatccacacctc
gtccacgggtggatgcgcggctcgcacgcaggtccgcttatgccagcgcgcttcatttcc
atagatcccgaaaggagaattgccataggcgccaaaatgacccgcttcgacggaccgccc
aaagtcggcgccctaggcttccagctacacgacggatacttagaaggcggcgttgaccta
ttcgatgacccggcctttgactacgttaggcaagtcgcggcccaaatagcagattacata
cgcagaatggggcccttccagccacaccgcctcccgccagaagagatggaatacacagcc
ctgcctaaaatcttggcaaaaattaaggcctaccccgccgacaagtacgaaaaagagagg
aggaaatacatcgaagcaatagtaaaaggagaaaaagtagaggagtctcaacacgactaa

DBGET integrated database retrieval system