KEGG   Pyrobaculum oguniense: Pogu_2363Help
Entry
Pogu_2363         CDS       T01735                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pog  Pyrobaculum oguniense
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2052905..2054359
Genome map
AA seq 484 aa AA seqDB search
MMERPLRFVRMASGVHVVALMTQPFPCPGRCTFCPTSADAPKSYMPDSPVVLRAKRNRYD
PYLQTAGRIKVYLENGHTPSKIEAVVMGGTFSALPRSYREWFVANVYKALNDYPHWAPAA
DPAPDLEAEQLRNEAASLRLAALAVETRPDFVDEAEVDFLLRLGVTRVELGVQSIYDDVL
QRVKRGHGVAEVARATALLKDSAYKLCYHLMPGLPGSDPDRDFEMVKEVFSDPRFMPDCV
KIYPTYVVPGTELYEEWRRGAYKNYDEGAWLELLAKIYASVPRWARVMRLGRDIPLHHVV
DGPRWGNMRQMVLRHMERLGLKCMEIRCREVGIRLANNVPIQPGPVEVKKTEYEASGGVE
IFLEAVGPDDTLYAILRLRIPGKPHRPELRKAALVRELHVYGPAVPVGEQGIWWQHTGLG
RGLMTRAEEIAREHGMLKIAVISGVGAREYYRKLGYSRCGPYMCKPIGAPLGYADDYLAA
SESI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgatggagagacccctccgctttgtcagaatggcaagcggcgtccacgtcgttgccctc
atgacacagcccttcccctgccccggccggtgcaccttctgcccgacctcggccgacgcc
cccaagtcctacatgccggacagccccgtggtgctccgcgccaagaggaataggtacgat
ccgtacttacagacggcgggccggataaaagtgtatctcgaaaacggccacacgccctct
aagatagaggccgttgtgatgggcggcaccttcagcgcgttgccgcggagctaccgggag
tggttcgtagccaacgtgtacaaggcgcttaacgactacccccactgggccccagccgcc
gaccctgcccccgatcttgaggccgaacagctgaggaatgaggcggcgtccctccggctg
gcggccctggccgtggagaccaggccggatttcgtggacgaggccgaggtggacttcctc
cttaggctcggcgtcaccagggttgagctcggcgtccagtccatatacgacgacgttttg
cagagggttaagaggggccacggcgtggccgaagtggccagagccaccgcgcttctgaaa
gactcggcgtataagctgtgttaccatctgatgccgggactccccgggagcgacccagac
cgcgactttgagatggtgaaggaggtgttttctgacccccgcttcatgccggactgcgtc
aagatataccccacctacgtggtgccggggactgaactctacgaggagtggcgccgcggc
gcgtataagaactacgacgagggggcttggctggagctgttagcgaagatatacgcgtca
gtcccccgctgggccagggtgatgaggctcggcagggacatccccctccaccacgtcgtg
gacggccccaggtggggcaacatgcggcagatggtgctgaggcacatggagagactgggc
ctgaagtgcatggagattaggtgcagggaggtgggcataaggcttgctaacaacgtgccg
atccagccggggcccgttgaggttaagaagacggagtacgaggcctccgggggcgtggag
atatttctagaagccgtcggcccagacgacaccctatacgcaattctgcggctgaggatc
cccggcaagccgcataggcctgagctacgcaaggcggcgcttgtgagggagctccacgtc
tacggccccgccgtacccgtgggggagcagggcatttggtggcaacacacaggcctcggc
agaggcctgatgacccgcgccgaggagatcgccagggagcatggcatgttgaaaatcgcg
gttatctccggggtcggggcgagggagtactaccgcaagctgggctacagcagatgcggc
ccctacatgtgcaagcccataggcgcgccgctcggctacgcagacgactacctcgccgca
agcgaaagtatttaa

DBGET integrated database retrieval system