KEGG   Pyrobaculum oguniense: Pogu_2411Help
Entry
Pogu_2411         CDS       T01735                                 

Definition
sugar kinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pog  Pyrobaculum oguniense
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pogu_2411
Enzymes [BR:pog01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Pogu_2411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2090456..2091370)
Genome map
AA seq 304 aa AA seqDB search
MKVASIGNLNFDIYLRISELPGPDENIEALDLYTGGGGSAANFAVAIARMGLGARFIGAV
GDDPLGDISLRELLAEGVEVAVKRVTGVRSGVVVVLVHPDGIKRMVSFRGANLGLTPADL
TPDKFEGVNHIHLATGRTELITKAKEIAREVGASVSVDGGTALARKGLEIVRATVEGVDV
VFMNHVEAKMLANTGDHRSAVEKLAKELKVGELVVTLGPLGAVAYRGGKLLHVDAFKVAA
LDTTGAGDSFAAAYIAMHLRGRDLYEKLLFANAAAAIKVTRPGARSSPRYDEVRSFLESL
GYKI
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtggcgtctattgggaacctcaattttgacatatatctcagaatatccgagttg
cccggccccgacgagaacatcgaggcgttggacttgtacactgggggcggaggctctgcc
gcgaatttcgccgtggcgatagctagaatgggcctcggcgccaggttcataggcgcagtt
ggcgacgacccccttggagatatatcgctaagagagctcttggccgagggcgtcgaggtt
gctgtgaagagggtgaccggagttaggtcgggggttgtcgtcgttctcgtgcacccagac
ggtattaagagaatggtgtcgtttcgcggcgccaacctgggcctcaccccggcggacttg
actccggacaagttcgagggcgttaatcacatccacttggccaccggcaggactgagctg
ataaccaaggcgaaggaaattgccagagaagtaggcgcctcggtgtctgtggacgggggg
accgcactggcgaggaaggggctggagatcgtcagggcgactgtagagggcgtcgacgtg
gtttttatgaaccacgtagaggctaaaatgctcgccaacaccggcgatcacagatctgct
gtggagaagctggcaaaagagcttaaagtcggcgagctagtcgtcacgctcggccccctc
ggcgccgtagcatatagaggaggaaaacttctacatgtagatgctttcaaagtcgctgcg
ttggacacaacgggggctggcgacagcttcgcggcggcgtacatagccatgcacctaaga
gggagggatttgtacgaaaagttgttattcgccaacgccgcggcggctattaaggtgacg
aggccgggcgcccgctcgtcgccgaggtatgacgaagtccgctcttttcttgagtctctt
gggtacaagatttaa

DBGET integrated database retrieval system