KEGG   Pyrobaculum oguniense: Pogu_2517Help
Entry
Pogu_2517         CDS       T01735                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pog  Pyrobaculum oguniense
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2184935..2185552)
Genome map
AA seq 205 aa AA seqDB search
MAKKLVDDLEREGVLKSERVKKALLSVPREEFVMPEYRMMAYEDRPLPLFADATISAPHM
VAMMCELIEPRPGMSILEVGTGSGYHAAVCAEAIERRGKVYTVEIVKGLAIYAAQNLERL
GYWGVVEVFHSDGKRGLEKFAPYDAIIVTAAAASIPSALVNQLKDGGIMVIPVEEGFGQV
LYKVVRRGEKTEKKAVTYVLFVPLR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaacttgtcgacgatctggagcgcgaaggtgttctaaaaagcgagcgggtg
aaaaaggcgcttctgtcagttccgagagaggagtttgtcatgcctgaatacaggatgatg
gcatatgaggataggccccttccgctatttgcagacgccactatctcggcccctcacatg
gtggccatgatgtgcgagctaatagagccaagacctggtatgagtatcttggaggtcggg
actgggtccggctaccacgcagctgtatgcgccgaggccatagagaggaggggtaaggta
tatacagtggagattgtgaaggggcttgctatttacgccgcgcagaatctagagagactg
ggatattggggcgttgtggaggtttttcacagcgatggaaagagggggctggagaaattt
gcgccgtacgacgcaattatcgttactgcggcggctgcgtcaataccatctgcgcttgta
aaccagttgaaagacggcggtatcatggtgattcccgttgaggaaggatttgggcaagta
ctttacaaagtggtaaggaggggggagaagacggagaagaaggctgtgacgtatgtgctt
ttcgtaccgttgaggtag

DBGET integrated database retrieval system