KEGG   Pyrobaculum oguniense: Pogu_2589Help
Entry
Pogu_2589         CDS       T01735                                 

Definition
NADH:ubiquinone oxidoreductase 49 kD subunit 7 (EC:1.6.5.3)
Orthology
K00333  
NADH-quinone oxidoreductase subunit D [EC:1.6.5.3]
Organism
pog  Pyrobaculum oguniense
Pathway
Oxidative phosphorylation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Pogu_2589
Enzymes [BR:pog01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     Pogu_2589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2242514..2243734
Genome map
AA seq 406 aa AA seqDB search
MLDEWPFNLRFGDTYYVEREEELVGGRRGLTLVVGPQHPGSGHMRIFLVLDGDVIVDAFP
DPGFVHRGIEKLAENRPYWTLIPLVEKASIMDSANIIYPLVLALEKSLALEPPPRAKYLR
LIMAELTRIRTHLYDLALLGIFLGHSTAFMWGFALQDLIAEVFAKIAGARTTTAYLVPGG
VRRDFKPDHVELVERLLRKVEAKLNDFKNLFLDNPVTRARLEGVGVLDAKRVAELGVVGP
FARASGVDFDVRRAYPYDAYAELGYEPVVDKAGDAWARTWVRWEEVRRSIELVRRALREL
PQGDVIDSALLFKNPEYRREGISGVMGVYTYMYPEPGEWLGVAEATRGLALAQLWASGLQ
RVYRMRFVTPSWRNLRAMIEAMKGERLADMPAVYMSFGYFPPEADR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgaatggccttttaacttgaggttcggcgacacgtactacgtggagagggag
gaggagctagttggcggccgccggggtctgacgcttgtcgtcgggccgcaacatcccgga
tcgggccacatgcggatcttcctcgtgctggacggcgacgtcatcgtagacgccttccct
gacccgggctttgtccaccgcggaatagaaaagctggctgagaacaggccctactggaca
ttgataccgttggtggagaaggcctccatcatggacagcgccaacatcatttatcccctc
gtgctggcgcttgaaaagagtctcgccctggagccgccgccgcgggcgaagtatctgcgg
ctgatcatggcggagcttacgcgtattaggacccacctctacgacttggcgcttctcggc
atcttcctaggccactccaccgcctttatgtgggggttcgccctgcaggacctcatcgcc
gaggtctttgccaagatcgccggcgccaggaccaccacggcgtacctcgtgccggggggt
gtgcggagggatttcaagcccgaccacgtagagcttgtggagaggctgttgaggaaggtc
gaggccaagctcaacgatttcaagaatctatttttggacaaccccgtgacaagggcgagg
ctggagggggtgggcgtcttggacgcgaagagggtggccgagctaggggtggtgggcccc
tttgccagggcctccggcgttgattttgacgtgaggagggcctatccgtacgacgcctat
gcggagctgggctacgagccggttgtggacaaggccggcgatgcttgggcgaggacgtgg
gttaggtgggaggaggtgaggaggtcgattgagcttgtgcgcagggcgcttagggagcta
ccacaaggtgacgtgattgacagcgccctcctcttcaaaaaccccgagtacaggcgggag
gggatttcaggtgttatgggcgtgtatacatacatgtaccccgagccgggcgagtggctg
ggcgtggccgaggctacgcgtggactcgccctagctcagctctgggcctcagggttgcag
cgggtatatcgtatgaggttcgtcacgccgtcgtggcgcaacctccgtgccatgatagag
gctatgaagggagagaggctggcggatatgcctgctgtgtacatgagcttcgggtacttc
cctcccgaggctgataggtga

DBGET integrated database retrieval system