KEGG   Pyrobaculum oguniense: Pogu_2589Help
Entry
Pogu_2589         CDS       T01735                                 

Definition
NADH:ubiquinone oxidoreductase 49 kD subunit 7 (EC:1.6.5.3)
Orthology
K00333  
NADH-quinone oxidoreductase subunit D [EC:1.6.5.3]
Organism
pog  Pyrobaculum oguniense
Pathway
Oxidative phosphorylation
Metabolic pathways
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:pog00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2242514..2243734
Genome map
AA seq 406 aa AA seqDB search
MLDEWPFNLRFGDTYYVEREEELVGGRRGLTLVVGPQHPGSGHMRIFLVLDGDVIVDAFP
DPGFVHRGIEKLAENRPYWTLIPLVEKASIMDSANIIYPLVLALEKSLALEPPPRAKYLR
LIMAELTRIRTHLYDLALLGIFLGHSTAFMWGFALQDLIAEVFAKIAGARTTTAYLVPGG
VRRDFKPDHVELVERLLRKVEAKLNDFKNLFLDNPVTRARLEGVGVLDAKRVAELGVVGP
FARASGVDFDVRRAYPYDAYAELGYEPVVDKAGDAWARTWVRWEEVRRSIELVRRALREL
PQGDVIDSALLFKNPEYRREGISGVMGVYTYMYPEPGEWLGVAEATRGLALAQLWASGLQ
RVYRMRFVTPSWRNLRAMIEAMKGERLADMPAVYMSFGYFPPEADR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgaatggccttttaacttgaggttcggcgacacgtactacgtggagagggag
gaggagctagttggcggccgccggggtctgacgcttgtcgtcgggccgcaacatcccgga
tcgggccacatgcggatcttcctcgtgctggacggcgacgtcatcgtagacgccttccct
gacccgggctttgtccaccgcggaatagaaaagctggctgagaacaggccctactggaca
ttgataccgttggtggagaaggcctccatcatggacagcgccaacatcatttatcccctc
gtgctggcgcttgaaaagagtctcgccctggagccgccgccgcgggcgaagtatctgcgg
ctgatcatggcggagcttacgcgtattaggacccacctctacgacttggcgcttctcggc
atcttcctaggccactccaccgcctttatgtgggggttcgccctgcaggacctcatcgcc
gaggtctttgccaagatcgccggcgccaggaccaccacggcgtacctcgtgccggggggt
gtgcggagggatttcaagcccgaccacgtagagcttgtggagaggctgttgaggaaggtc
gaggccaagctcaacgatttcaagaatctatttttggacaaccccgtgacaagggcgagg
ctggagggggtgggcgtcttggacgcgaagagggtggccgagctaggggtggtgggcccc
tttgccagggcctccggcgttgattttgacgtgaggagggcctatccgtacgacgcctat
gcggagctgggctacgagccggttgtggacaaggccggcgatgcttgggcgaggacgtgg
gttaggtgggaggaggtgaggaggtcgattgagcttgtgcgcagggcgcttagggagcta
ccacaaggtgacgtgattgacagcgccctcctcttcaaaaaccccgagtacaggcgggag
gggatttcaggtgttatgggcgtgtatacatacatgtaccccgagccgggcgagtggctg
ggcgtggccgaggctacgcgtggactcgccctagctcagctctgggcctcagggttgcag
cgggtatatcgtatgaggttcgtcacgccgtcgtggcgcaacctccgtgccatgatagag
gctatgaagggagagaggctggcggatatgcctgctgtgtacatgagcttcgggtacttc
cctcccgaggctgataggtga

DBGET integrated database retrieval system