KEGG   Pyrobaculum oguniense: Pogu_2611Help
Entry
Pogu_2611         CDS       T01735                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pog  Pyrobaculum oguniense
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pogu_2611
Enzymes [BR:pog01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Pogu_2611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2260596..2261228
Genome map
AA seq 210 aa AA seqDB search
MSVDSRVVVVRVKDGPCPEGAFCVSIGRVVPRRGVEVPDGDYLVVMSPAVADAVDVAALA
GRFRCVICVGPSTAARVGKCVVPREYTSYGIAELLKSLAPGRVVVLRSSSGNEVLRSLVP
NVVEVAVYDLVIDEERVREVAGILSRAEAVVLTSAKAAEAVAKYVDLSGKTVVAIGRVTS
QKLAQLGVLHLVADEATIKSAVEAALRAIG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtggattcccgggtagtagtggtgagggtaaaagacggcccgtgtccggagggg
gctttctgcgtgtcgattgggagggttgtgcctaggagaggagtggaggtgcctgacggg
gactacctagtagtgatgagcccagctgtggccgacgccgttgacgtcgcggcgttggcg
ggtaggtttaggtgtgtaatttgtgttggcccctccaccgcggcgagggttgggaagtgc
gtggtgccgcgtgaatacacgagctatgggatcgccgagcttttgaaaagcctcgccccg
ggccgggttgtggttttgaggtctagctcggggaacgaagttttgcggtcattagtgcct
aatgtcgtcgaggtggcggtgtacgacctcgtaatagacgaggagagggtcagagaggtt
gcgggaattttaagccgcgccgaggctgtggtcttgacgagcgcaaaagcggcggaggcc
gtggcgaaatacgtggatctaagtgggaaaactgtagtggccatcggcagggtgacttcc
caaaagctggcccagctcggcgtcctccacctagtggctgatgaggcgacgattaaaagt
gcagttgaggcggcgcttagggcgattggttaa

DBGET integrated database retrieval system