KEGG   Pyrobaculum oguniense: Pogu_2614Help
Entry
Pogu_2614         CDS       T01735                                 

Definition
Delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pog  Pyrobaculum oguniense
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pogu_2614
Enzymes [BR:pog01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Pogu_2614
Exosome [BR:pog04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pogu_2614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2262131..2263147
Genome map
AA seq 338 aa AA seqDB search
MHVRFPQHRPRRLRATKLIRDAVAETSLDPGDFIYPIFVKPSGEKEQIPSMPGQYRWPVG
DELTRHVEEALALGVNKVILFGVVPDELKDPAGSLGYDPHGVVPNAIRLLKQTFGDKLLV
FADVCLCEYTDHGHCGVVRERRGRWYVDNDETIKLYAKEAVAYADAGADFVAPSGMMDGQ
VAEIRKALDSHGFHDVGIMAYSAKYASAFYGPFRVAAASAPKFGDRRTYQMDPRNAYEAV
KEVMLDLEEGADIVMVKPALAYLDVIRIVKTQLPWAPLAAYNVSGEYSMVKAAASLGYVD
ERVVTLEILTAIKRAGAQLILTYHALEAARWLKEGVPF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtgcggttcccccagcacaggcctaggcgtctcagagccaccaagctgattaga
gacgccgtggctgagacatcgctagaccccggcgacttcatataccccatttttgtcaag
ccttctggcgagaaggagcaaataccctccatgcccggccagtacaggtggcctgtgggg
gacgaattgacaaggcacgtggaggaggccctcgccttgggcgtgaacaaggtgattctc
ttcggggtggtgcccgacgagctgaaagacccggctgggtccctgggctacgacccacac
ggcgtggtgccgaacgccatccggttgctgaaacagaccttcggcgacaagttgcttgtg
tttgccgatgtctgtctctgcgagtacacagatcacggccactgcggcgttgtgagggag
aggagggggaggtggtatgtggacaacgacgagactataaagctgtacgcaaaagaggca
gtggcctacgccgatgccggtgcggattttgtagcgccaagcggaatgatggacggacaa
gtggcggagataagaaaggcgctggactcacatgggtttcacgacgttgggattatggca
tatagcgccaagtacgcctcggcgttttacgggcctttcagagtggccgccgcctcagcg
cctaaattcggcgataggaggacataccagatggaccccagaaacgcctacgaggccgtc
aaggaggtcatgctcgacttagaggagggcgcagacatagtcatggtgaagccagcgctg
gcctacctcgacgtaatccgcatcgtgaagacgcaactcccgtgggcccccctcgccgcc
tacaacgtgtcgggggagtactccatggtcaaagccgccgcctccctcggctacgtagac
gaacgcgtcgtcacgttggagattttaacagcgataaagagggcaggtgctcagctaatc
ctcacctaccacgccctcgaagccgccaggtggttgaaagagggcgtgccgttttaa

DBGET integrated database retrieval system