KEGG   Pyrobaculum oguniense: Pogu_2623Help
Entry
Pogu_2623         CDS       T01735                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pog  Pyrobaculum oguniense
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pog01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pog00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2271207..2271956
Genome map
AA seq 249 aa AA seqDB search
MDFLAQVKKAVELRLATEPSPPARSLPLVDFSKALGEFGIIAEYKRASPRGVVRLDMQPW
AYFAMLQPYAAAFSVLTEPFWFLGDYRFIPMAKPFKPVLMKDFVLDKRQIEIAYGYGADA
VLIIYRLVGREKAMELAEYAQRLGLTPVVEVDNLQDAKEAATWGGKIMLGINSRDLATLE
VSFHKAIEIAKALRGDVDFIIESGISKPEEVEKACMLYAKGVLVGTALMKNPALIKELRH
AAESCVSRR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtggacttcctggcccaggttaaaaaggccgtggagctccgcctcgccaccgagccgagt
ccccccgcgaggtcgctgccccttgtcgatttctcgaaggcactgggggaatttggaata
attgccgagtataagagagcgtctccgcggggggttgtgcgtcttgacatgcagccgtgg
gcctacttcgccatgcttcagccctatgcggccgcgttttcggtacttacagagcccttc
tggtttctcggcgactaccgattcatccccatggccaagcccttcaagccggtactcatg
aaagacttcgttttggacaaaagacaaattgaaattgcatatggatacggcgcagacgcc
gtcctcataatctatcgcctagtgggaagggagaaggccatggaactcgcggagtacgcc
cagcggcttggcttgacgccggtggtggaggtagacaacctccaagacgccaaggaagcc
gccacgtggggaggcaagatcatgttgggcataaattccagggacttagccacgctggag
gtgagcttccataaggcgattgagatcgctaaggcgttgcggggtgacgtcgactttata
atagagagcggtatatcaaagccagaggaggtggaaaaagcatgtatgctatacgccaag
ggagtcctcgtcgggacagccctaatgaaaaaccccgcattaataaaggagcttaggcac
gccgccgagtcgtgtgtctcgcggcggtga

DBGET integrated database retrieval system