KEGG   Polaromonas sp. JS666: Bpro_0190Help
Entry
Bpro_0190         CDS       T00343                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pol  Polaromonas sp. JS666
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Bpro_0190
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bpro_0190
Enzymes [BR:pol01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Bpro_0190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(208345..208830)
Genome map
AA seq 161 aa AA seqDB search
MNTVYAFEARQINGQNIPLSEFSGKVMLIVNTASQCGFTPQFGGLEELHKTYAGKGLAVL
GFPCNQFGSQDPGSDGEIAEFCQVNYGVSFPMMSKIDVNGPAAHPLYKWLTAEAPGLLGS
KSIKWNFTKFLVGKNGQVIKRYAPTDKPAELARDIEAALAA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgtttacgcttttgaagcccgccagatcaatggccagaacatcccgctttcc
gaattcagcggcaaggtgatgctgatcgtgaacaccgccagccagtgcggcttcacgccg
cagtttggcgggctggaagaactgcacaaaacctatgccggcaaggggctggcggtgctg
ggctttccgtgcaaccagtttggttcgcaggacccgggcagcgatggcgaaatcgccgag
ttctgccaggtcaactacggggtcagttttcccatgatgtccaagatcgacgtcaacggc
cccgccgcgcacccgctgtacaagtggctgaccgccgaggcgccggggctgctgggcagc
aagtccatcaaatggaacttcaccaagttcctggtcggcaagaacggccaggtgatcaag
cgctatgcaccgaccgacaagcccgccgagctggcccgggacattgaggcagcgctggcc
gcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system