KEGG   Polaromonas sp. JS666: Bpro_0661Help
Entry
Bpro_0661         CDS       T00343                                 

Definition
D-serine deaminase
Orthology
K01753  
D-serine dehydratase [EC:4.3.1.18]
Organism
pol  Polaromonas sp. JS666
Pathway
Glycine, serine and threonine metabolism
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pol00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
672521..673819
Genome map
AA seq 432 aa AA seqDB search
MTTLQDILDPQIDRSFKGFPHTSPALRRSQIAAQHWRVLDGDLPLPVALVKQQALQHNLS
WMQRFATDRGIDMAPHGKTTMSPQLLKRQLDAGAWGLTFATVAQLRAGVLAGARRCMIAN
QVFTAADLAGIQDMQREYAGLRIAFLVDSAAQLELIEAWHASQQDAQTPVRPFEVLLEIG
VEGGRTGCRNQHDALTLAQRVHASPACRLVGIECYEGLGATGQSDPDEAYAGALMQRVCD
IAIACDQQHFFDNEEVLVSAGGSAIFDLVANRLKPELSQPVRGLLRSGCYVTHDHGFYKR
MVSTVNSRLGCGDGLQAALEVWAAVQSCPEPGLAILAVGKRDISYDLDLPVPLGFCKPGD
RGVTGAPADWKIGGLNDQHAYLRGTGPEHAALKVGDLVALGISHPCTTFDKWRWMPVVDE
NYTVCDALVTCF
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaccacactgcaagacattctcgatccgcagatcgaccgctccttcaagggatttccg
cacaccagccctgcgctgcgccgttcgcagattgccgcccagcactggcgcgtgctcgac
ggcgacctgccgctgcccgtggcgctggtcaagcagcaggccctgcagcacaacctgtcc
tggatgcagcgcttcgccaccgaccggggcatcgacatggcgccgcatggcaagaccacc
atgtcgccgcaactgctcaagcgccagctcgatgcgggcgcctggggcctgacctttgcc
accgtcgcccagttgcgtgccggcgtcttggcgggcgcgcgccgctgcatgattgccaac
caggtcttcaccgcggcagacctcgccggcattcaggacatgcagcgcgagtacgcaggc
ttgcgcattgcctttctggtggattcggcggcacagctggagcttattgaggcctggcat
gcgtcgcaacaggatgcgcaaacgccggtgcggccttttgaggtgctgctggaaatcggt
gtcgagggcggccgcaccggctgccgcaaccagcacgatgccctgacgctggcccaacgc
gttcatgccagcccggcttgccgcctggtcggcatcgagtgttacgaaggcctgggcgcg
accggtcagtccgacccggacgaggcctatgcgggggcgctgatgcagcgcgtgtgcgac
atcgccattgcctgcgaccagcagcatttttttgacaatgaggaagtgctggtctcggcc
ggcggttcggcgatttttgacctggtggccaaccgcctcaaacccgaactctcgcaacct
gtgcgcggcctgttgcgctcgggctgctacgtcacgcatgaccacggtttttacaaacgc
atggtgagcacggtcaattcacgcctcggctgcggcgatggcctgcaggccgcgctggaa
gtctgggcggcggtgcagtcctgccccgagccgggtctggcgattcttgcggtcggcaag
cgcgacatttcctacgatctggatttgcccgtgccgctgggcttttgcaaacccggcgac
cgcggcgttaccggtgcacccgccgactggaagatcggcggcctgaacgaccagcatgcc
tacttgcgcggcaccggccccgagcatgcggcgctcaaggtgggcgacctggtggcgctg
ggcatttcgcacccctgcaccacgtttgacaaatggcgctggatgcccgtggtggatgag
aactacaccgtgtgcgatgccctcgtaacctgtttctga

DBGET integrated database retrieval system