KEGG   Polaromonas sp. JS666: Bpro_0802Help
Entry
Bpro_0802         CDS       T00343                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pol  Polaromonas sp. JS666
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bpro_0802
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bpro_0802
Enzymes [BR:pol01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Bpro_0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
827963..829237
Genome map
AA seq 424 aa AA seqDB search
MDKLLIKGGRSLAGTVDISGAKNAALPELCAALLTADTVTLENVPRLQDVATMLKLIRNM
GVEAERGTHAPGTVTLHAGALSSPEAPYELVKTMRASVLALGPLLARFGEATVSLPGGCA
IGSRPVDQHIKGLQAMGAEIVVEHGYMIAKLPAGQKRLKGVSITTDMVTVTGTENFLMAA
SLAEGETILENAAQEPEIGDLADMLIKMGAKIEGHGTRRIRIQGVERLHGCTHQVVADRI
ETGTFLCAVAAAGGDVVLRHGRADHLDAVIDKLREAGATITAGEGFIRIQAQGRMKAQSF
RTTEYPGFPTDMQAQFMALNAIAQGSSTVTETIFENRFMHVNEMVRLGAKIQIEGKAAVM
EGVEKLSGATVMATDLRASASLVIAGLVAEGETLVDRIYHLDRGYDQMEAKLRGIGADIE
RVRA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactactcatcaagggcggcagatcgctcgccggcaccgtcgatatctcgggc
gccaagaatgccgccctcccggaactgtgcgcggcgctgctcacggccgacactgtgacg
ctggagaacgtgccgcgcctgcaggacgtggccaccatgctcaagctgatccgcaacatg
ggcgtggaagccgaacgcggcacccatgcgccgggaaccgtcaccctccatgccggcgcc
ttgagctcgcccgaagcgccctatgaattggtgaagaccatgcgcgcctccgtgctggcg
ctgggcccgctgctggcgcgctttggcgaagccacggtgtcgctgcccggtggctgcgcc
attggctcgcggccggtagaccagcacatcaagggcctgcaggccatgggcgccgagatc
gtggtcgagcacggctacatgattgccaaacttcctgcgggtcaaaagcgcctcaagggt
gtcagcatcaccaccgacatggtgaccgtcaccggcacggaaaacttcctgatggccgcc
agcctggccgaaggcgaaacgattctggaaaacgccgcgcaggagcccgagatcggcgac
ctggctgacatgctcatcaagatgggcgcgaagatcgaaggccacggcacgcgccgcatc
cgcatccagggcgtggagcgcctgcatggctgtacccaccaggtggtggccgaccgcatt
gaaaccggcacctttctgtgcgcggtggccgcggcgggcggcgatgtggtgctccggcat
ggccgggccgaccacctcgatgcggtcatcgacaagctgcgcgaagcgggcgccaccatc
acggccggcgagggattcatccgcatccaggcgcagggccgcatgaaggcccagtccttc
cgtaccacggaatatccgggttttcccaccgacatgcaggcccagttcatggcgctcaac
gccattgcacagggcagcagcacggtcaccgaaacgatttttgaaaaccgcttcatgcac
gtcaacgagatggtgcgcctgggtgcgaagatccagatcgaaggcaaggcggccgtcatg
gaaggcgttgaaaaactttcgggcgccaccgtcatggccaccgatctgcgggcttccgcc
agcctggtgattgccggcctggtggccgaaggcgaaaccctggtggaccggatttaccac
ctggaccgcggctacgaccagatggaggccaaattgcgcggcatcggtgcagacatagaa
cgggtaagggcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system