KEGG   Polaromonas sp. JS666: Bpro_0869Help
Entry
Bpro_0869         CDS       T00343                                 

Definition
GTP cyclohydrolase (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pol  Polaromonas sp. JS666
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bpro_0869
Enzymes [BR:pol01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Bpro_0869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
893062..893784
Genome map
AA seq 240 aa AA seqDB search
MLMKSTTHPQGSTDEGTPVSVKIRERLHQARKRFHANDNIAAFIEPGELEKLLDEVEVKM
QTVLDSLVIDTAGDHNTNNTARRVAKMYLNEVFKGRYVQPPTITEFPNAEHLNELMIVGP
ITVRSACSHHFCPVIGKIWIGVMPNEHTNVIGLSKYARLAEWVMGRPQIQEEAVVQLADL
IMEKTQPDGLAIVMEASHYCMAWRGVKDMDSKMINSVMRGVFLKDPNLRREFLALIPQKG
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcttatgaaatccaccacgcacccccaggggtccaccgacgagggaacgcccgtatcc
gtgaagatccgcgagcgcctgcatcaggcacgcaagcgttttcatgcgaacgacaacatt
gccgcgttcattgaaccgggcgagctcgaaaagctgcttgacgaagttgaagtcaagatg
cagaccgtgctcgacagcctggtgatcgataccgccggcgatcacaacaccaacaacacc
gcgcgccgcgtcgccaagatgtatctgaacgaggtgttcaagggccgttatgtgcagccg
cccaccatcaccgaattccccaatgccgaacacctcaacgaattgatgatcgtcgggccg
atcaccgtgcgcagcgcctgctcgcaccacttctgcccggtcatcggcaagatctggatc
ggggtgatgcccaatgaacacaccaatgtgatcggcctgtccaaatacgcgcggctggcc
gagtgggtgatggggcgcccgcagatccaggaagaggccgtggtgcagctggccgatctc
atcatggagaaaacacagccggatggcctggccatcgtgatggaagccagccactactgc
atggcctggcgcggtgtcaaggacatggacagcaagatgatcaattcggtgatgcgcggc
gtattcctgaaggaccccaacctgcgccgtgaattccttgccctgattccacagaaagga
tga

DBGET integrated database retrieval system