KEGG   Polaromonas sp. JS666: Bpro_0886Help
Entry
Bpro_0886         CDS       T00343                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pol  Polaromonas sp. JS666
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bpro_0886
   01230 Biosynthesis of amino acids
    Bpro_0886
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bpro_0886
  Energy metabolism
   00680 Methane metabolism
    Bpro_0886
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bpro_0886
Enzymes [BR:pol01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bpro_0886
Exosome [BR:pol04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bpro_0886
  Exosomal proteins of melanoma cells
   Bpro_0886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(907697..908578)
Genome map
AA seq 293 aa AA seqDB search
MFFTKPVILEWRPEIAYRLPLLPLPAAPFLTPVFTSSLSFPPDCHTMYKLVLIRHGESTW
NLENRFTGWTDVDLTETGIQQAKDAGKLLKAEGYDFDLAYTSVLKRATRTLWHVLDEMDR
TWLPVVNSWRLNERHYGALQGLNKAETAKKYGEDQVLIWRRSYDTPPPPLAANDERCERG
DPRYAKLPPEQVPLTECLKDTVARVLPFWNESMAPAIKAGKRVVVAAHGNSIRALVKYLD
NISDSDIVGLNIPNGIPLVYELDAQLRPLRHYYLGDSEAAARAVAAVSAQGKA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgtttttcaccaaaccagtgattttagaatggaggccggaaattgcctaccggctgcct
cttttacccctgcctgctgcaccctttctcacccccgttttcacttcatccctctccttc
ccacccgactgccacaccatgtacaaactcgtactcatccgccatggcgaatccacctgg
aaccttgaaaaccgatttaccggctggaccgatgtcgacctgacggaaaccggcatccag
caagccaaggatgccggaaagctgctcaaggccgagggttacgactttgacctggcctac
accagcgtgctcaagcgcgccacccgcaccctctggcatgtgctggacgagatggaccgg
acctggctgccggtcgtgaacagctggcggctgaacgagcgccattacggcgcgctgcag
ggcctgaacaaggccgagacagccaaaaaatatggcgaagaccaggtactgatctggcgc
cgcagctatgacacgccgcccccgccgctggcggccaacgacgagcgctgcgaacgcggc
gacccccgctatgccaagctgccgcccgagcaggtgccgctgacggagtgcctgaaagac
acggtggcgcgggtgttgcccttctggaatgagtccatggcacccgccatcaaggccggc
aagcgcgtggtggtggctgcccacggcaactcgatacgcgcgctggtgaagtacctggac
aacatctccgacagcgacatcgtgggactcaacatccccaacggcattccgctggtgtat
gagctggatgcccagctcaggcccctgcgccactactacctgggcgacagcgaagccgct
gccagggccgtggcggccgtcagcgcccagggcaaggcctga

DBGET integrated database retrieval system