KEGG   Polaromonas sp. JS666: Bpro_1070Help
Entry
Bpro_1070         CDS       T00343                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pol  Polaromonas sp. JS666
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pol00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pol00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1100565..1102070
Genome map
AA seq 501 aa AA seqDB search
MTTQLHTPEQAARWLRERVTGSLRTDSRMVGGGDGFIAWPGAATDGRKYLGDALASGARA
CLVELQGFEPRGPDDERVAAYAGLKAATGPIAAAYFDEPSRHLQVAAVTGTNGKTSTTWW
LAQALGRLGRKCGVVGTLGIGAPGAVVFTGLTTPDPVLLQQQMRRFVDEGFATCALEASS
IGLVERRLDATTIQVAIFTNFTQDHLDYHPSMQDYWEAKKMLFSWPGLKAAVINVDDGKG
LELSASLAGSDLDVWTLSCTGPARIHAQKIHHGVNGVSFDVVEGAEQHRVSSKLVGQYNV
YNLLGVIAALRAMGIPLVDAVAACADLLPVPGRMDTLAEEGLPLVVIDYAHTPDALEKVL
TALQPVARSRGGQLWCVFGCGGDRDAGKRPLMAAVAEKNADRVVVTSDNPRSENPLAIID
QVLRGLNHRDAVHVQADRAMAITHALSLAQAHDVVLLAGKGHESYQEVQGVKLPFSDRTQ
AQAALALNAARVARQAGGGSA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
ttgacaacccagctccatacccccgagcaggcggcccgctggttgcgtgagcgcgtgacc
ggcagcctgcggacggacagccgcatggtgggcggcggtgacggattcattgcgtggcct
ggcgccgcgacggacggccggaagtatctcggtgatgcactggcttcgggcgcccgcgcc
tgcctggtggagttgcagggttttgagccccgcggcccggatgacgaaagggtggccgct
tacgcaggactcaaggcggcaaccggccccatcgccgctgcctattttgatgagccaagc
cggcatttgcaggtcgcggccgtcaccggcaccaatggcaagacatcgacaacatggtgg
ctggcccaggcgctgggcaggctggggcgcaaatgcggtgtcgtgggaaccctgggcatc
ggggcgcccggtgcggtggttttcacggggttgaccacccctgatcctgtgctgctccag
cagcaaatgcgccgttttgtggatgagggcttcgccacctgcgccctggaggcttcctcg
atagggctggtggagcggcggctggacgccaccaccatacaggtcgcgatcttcaccaac
ttcacgcaggaccatctcgactaccacccgtccatgcaggactattgggaggccaagaaa
atgctgttcagctggccaggcctgaaggcagcagtcatcaatgtggacgatggcaaaggc
cttgagctgagcgcgtcactggccggctcggacctggatgtctggacattgtcctgcaca
gggccggcccgaattcatgcacaaaaaattcaccacggcgtgaatggcgtgagttttgat
gttgtcgaaggcgcggagcagcaccgagtttccagcaagctggtcggccagtacaacgtg
tacaacctgctgggcgtcatcgcggccctgcgtgccatgggcataccgctggtcgatgcc
gtggctgcttgcgccgacctgctgccggtgccggggcgcatggacacgctggcggaagaa
ggcctgcccctggtcgtcatcgattacgcgcacacgcctgacgccctggaaaaagtactc
acagcgcttcagccggtcgcgcgcagccgcggtggccagctctggtgcgtctttggctgt
ggcggagaccgcgatgccggcaaacgcccgctgatggcagcggtggcggaaaaaaatgcc
gaccgggtggtggtcaccagcgacaacccgcgcagtgagaatccgctggccatcatcgac
caggtgctgagggggttgaatcaccgcgatgccgtgcacgtgcaggcagaccgggccatg
gcgattacgcatgcgctgagtttggcgcaagcccatgatgtggtgctgctggcgggcaag
gggcatgaaagttatcaagaggtccagggcgtgaagcttcctttttccgacaggacgcag
gcgcaagccgctctcgccctgaatgcggcgcgcgtggcacgccaggccgggggaggctcc
gcatga

DBGET integrated database retrieval system