KEGG   Polaromonas sp. JS666: Bpro_1122Help
Entry
Bpro_1122         CDS       T00343                                 

Definition
(RefSeq) short chain enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pol  Polaromonas sp. JS666
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Bpro_1122
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bpro_1122
   00650 Butanoate metabolism
    Bpro_1122
  Lipid metabolism
   00071 Fatty acid degradation
    Bpro_1122
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bpro_1122
   00310 Lysine degradation
    Bpro_1122
   00360 Phenylalanine metabolism
    Bpro_1122
   00380 Tryptophan metabolism
    Bpro_1122
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bpro_1122
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bpro_1122
   00281 Geraniol degradation
    Bpro_1122
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpro_1122
   00627 Aminobenzoate degradation
    Bpro_1122
   00930 Caprolactam degradation
    Bpro_1122
Enzymes [BR:pol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bpro_1122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1159603..1160391)
Genome map
AA seq 262 aa AA seqDB search
MSYETIVTSTQGPDTRKVGIITLNRPKQLNALNDQLMDELGSALKGFDADNSVGCIILTG
SDKAFAAGADISVMANYGFADVYNNDFITRNWEQIRGVRKPVIAAVSGFALGGGCELAMM
CDFIIAADNAKFGQPEIKLGIIPGAGGTQRLPRAVGKAKAMDMTLTGRMMDAAEAERAGL
VSRVVPLDKLMDEALGAALMICSYGPISLMAAKEAINRAFESGLSDGVMFERRLFHATFA
TDDQKEGMDAFLNKRKPVFSHR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgaaacgattgtgacctctacccagggccccgacacgcgcaaggtgggcatc
atcaccctgaaccggcccaagcagctcaacgcgctcaatgaccagctcatggatgaactg
ggaagcgcactcaagggctttgatgcggacaacagcgtgggctgcatcatcctgaccggc
agtgacaaggcctttgcagccggcgccgacatcagcgtcatggcgaactacggctttgcc
gacgtctacaacaacgatttcatcacccgcaactgggagcagatccgcggcgttcgcaag
ccggtgattgccgccgtgagcggttttgcgctgggcggcggttgcgagctggccatgatg
tgcgacttcatcattgccgccgacaacgcgaaattcggccagcccgaaatcaagctgggc
atcatccccggtgccggcggtacgcagcgcctgccgcgggcggtcggcaaggccaaggcg
atggacatgaccctgacaggacgcatgatggacgccgccgaggcagaacgcgccggcctg
gtcagccgggtagtgccgctggacaaactgatggatgaggcgttaggggcggctctgatg
atttgcagttatggcccgatttccctcatggccgccaaggaggcgatcaaccgcgccttt
gaaagcgggctcagtgacggcgtgatgtttgagcgacggcttttccacgcgaccttcgcc
accgatgaccaaaaagaaggcatggacgcctttttgaacaaacgcaagcccgtgttcagc
catcgctga

DBGET integrated database retrieval system