KEGG   Polaromonas sp. JS666: Bpro_1124Help
Entry
Bpro_1124         CDS       T00343                                 

Definition
putative thiol:disulfide interchange protein (periplasmic)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pol  Polaromonas sp. JS666
Brite
Enzymes [BR:pol01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Bpro_1124
Secretion system [BR:pol02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Bpro_1124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1162629..1163342)
Genome map
AA seq 237 aa AA seqDB search
MKFLKTIAVMGLIAFSLDAALAQEAAIRKNLAERLPVFSKIDEVSKTPMNGLYEIRVNET
EIFYTDAEGNFLLQGNLFDTRAKRNLTEERVEKLTAIDFGALPFKDAFTVVRGNGKRKMA
VFEDPNCGYCKRFERDLQKISDVTVYMFLFPILGPDSAEKSRNIWCAKDKAKAWTDLMVR
DQPAPKASCDTTVLERNLEFGKKRKITGTPTLFFVDGSRVPGAISAQQVEKLLTEAK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcttaaaaacaatcgccgtcatgggcctgatagcgttcagcctggatgctgcg
ctggcgcaggaagccgccatccggaaaaacctggcggaaagactgcccgttttctcgaag
atcgacgaagtcagcaaaacaccgatgaacgggttgtacgaaattcgcgtcaacgaaacc
gagattttctacaccgatgcggaaggcaattttttgctgcagggcaacctgttcgacacc
cgggccaaacgcaacctgaccgaagaacgcgttgaaaagctcaccgcgatagactttggc
gcgttgccattcaaggacgcctttaccgtggtgcgcggcaacggcaaacgcaagatggcg
gtctttgaagatcccaactgtggttattgcaagcggtttgaacgcgacctgcagaaaatc
agcgacgtgacggtttacatgtttctgtttcccatcctgggccccgattcggctgaaaaa
tcacgcaacatctggtgcgccaaggacaaggccaaggcctggaccgacctgatggttcgg
gatcaaccggcgcccaaggccagctgcgacacgaccgtcctggagcgcaacctggagttc
gggaaaaagcgcaagatcaccggcacccctaccctcttttttgtcgatggttcccgtgtg
ccgggcgccatcagcgcccagcaggtcgaaaagcttctcaccgaggccaagtaa

DBGET integrated database retrieval system