KEGG   Polaromonas sp. JS666: Bpro_1297Help
Entry
Bpro_1297         CDS       T00343                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pol  Polaromonas sp. JS666
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:pol00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Bpro_1297
Enzymes [BR:pol01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Bpro_1297
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Bpro_1297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1339735..1340550
Genome map
AA seq 271 aa AA seqDB search
MPELPEVEVTRLSFAGRIAGARIEAVSMGKPLRWPLGCSPQQLVGLRVLAVRRRGKYLLV
DLSDGLLLIHLGMSGSVSFGSSLSSPGKHDHFDMVTSLGTLRLNDPRRFGAVVYAGDEHD
AVAHKLLGRLGVEPLSDAFDAALFHQALKPRQTPIKQVLLGGEAVVGVGNIYASEALFLA
GIRPTTKASRISKPRAALLHRAIRQVLTQAVTKGGSTLRDFSNAQGEAGHFQLDAMVYDR
AGMPCKVCGSPIKSIRQGQRSTFYCVSCQKP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactgcccgaagttgaagtcacccgcctgagttttgcaggccgcattgcaggt
gcccgcatcgaagcggtgtccatgggcaaaccgctgcgctggccgctgggctgcagcccg
cagcaactcgtgggcctgcgggtgctggccgtgcggcgccgcggcaagtacctgctggtc
gacctgagcgatggcctgttgctgattcacctgggcatgtcgggcagcgtcagctttggc
tcgagtctgtcttcgcccggcaagcatgatcactttgacatggtgaccagccttggaacc
ttgcgcctgaacgacccgcgccgtttcggcgcggtagtgtatgccggagacgagcacgac
gctgtggcccacaagctcctgggccggctgggcgtcgagccgctcagcgacgcttttgac
gcggcgctgttccaccaggcgctcaagcccaggcagacccccatcaagcaggtcttgctg
ggcggtgaagcagtggttggcgtgggcaatatatacgcctcggaggcgctgtttctggcc
ggtatccggcctaccaccaaggcgtcccgcatcagcaaaccgcgcgcagcgttgctccac
cgcgccattcggcaggtattgacacaggccgttacaaaaggggggagcaccctcagggac
ttttccaatgcccagggcgaggccggtcattttcagctcgacgccatggtgtacgaccgt
gcgggcatgccctgcaaggtgtgcggatcgcccatcaaaagcatccggcagggccagcga
tcgactttttattgcgtcagttgccagaaaccgtga

DBGET integrated database retrieval system