KEGG   Polaromonas sp. JS666: Bpro_1822Help
Entry
Bpro_1822         CDS       T00343                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pol  Polaromonas sp. JS666
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bpro_1822
   00670 One carbon pool by folate
    Bpro_1822
Enzymes [BR:pol01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Bpro_1822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1886763..1887257)
Genome map
AA seq 164 aa AA seqDB search
MRINMIFARAANGVIGNNNRMPWHLPEDMAHFKRLTQGWPVIMGRKTWDSLPPKFRPLPG
RTNIVITRQQDWKEDGAEPAASLADALSLCGQSEEVWVIGGAQIYAQAKPLAQRIEVTEI
AQDFEGDAFAPPLGSEWIEAAREDHISSNGLKFSFITYDKHKGN
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcaacatgatttttgcccgcgccgccaacggcgtgatcggcaacaacaatcgc
atgccctggcatctgccggaagacatggcccacttcaagcgcctgacccagggctggccc
gtcatcatggggcgaaagacctgggactcactgccgcccaaattccgccccctgcccggc
cgcaccaatattgtcatcacccggcagcaggactggaaagaagatggcgccgagccagca
gccagcctggccgacgctttgagcctttgcgggcagtctgaagaagtctgggtcatcggt
ggcgcgcaaatttacgcgcaagccaagcccctggcgcagcgcatcgaagtcaccgaaatt
gcccaggactttgaaggggatgcctttgcgcccccgctgggttccgaatggattgaagct
gcgcgtgaggatcacatctcctccaatgggctgaagttcagttttatcacttacgacaaa
cacaaagggaattga

DBGET integrated database retrieval system