KEGG   Polaromonas sp. JS666: Bpro_2025Help
Entry
Bpro_2025         CDS       T00343                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pol  Polaromonas sp. JS666
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pol00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2095769..2096830
Genome map
AA seq 353 aa AA seqDB search
MTTNAEHLARLRARYAGASGADMFDPAFKAVAEQIFSSSDRRKWPFADVPTFLDAPYRAD
GLAQPEPNLAGLDVALIGVPMDLGVTNRAGARLGPRAVRNVERIGPYEHALGLAPVTRLK
MADVGDVPMRSRFSLDECHADIEACFNQVVNAGVIPLAVGGDHSITGSILKAVGRDRPVG
MVHIDAHCDTAGTYEGSKFHHGGPFREAVLAGVLDPRRCIQIGIRGGAEYLWEFSFDSGM
TVIHAEEFSKMGVEAVIRRAREVVGDGPTYVTFDVDSLDPAYAPGTGTPEVGGLSPREVL
TLLRGLAGLNIVGGDVMEVAPQNDPSGNTALVGAQMLFEILCLVALSPAMANR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgactaccaacgcagaacatttggccaggttgcgggcccgttatgccggcgcttcgggc
gccgacatgtttgacccggcattcaaggccgtcgctgaacagatcttcagcagctcggac
cgccgcaagtggccgtttgccgacgtccccacatttctcgatgccccttatcgcgcggat
ggcttggcccagcccgagccgaatctggcgggcctcgatgtggccttgatcggcgtgccg
atggacctgggcgtgaccaaccgcgccggggcccgcctggggccgcgggccgtgcgcaat
gtggagcgtatcgggccttacgagcatgcgctgggcctggcgccggtgacccgcttgaag
atggctgacgtgggcgatgtgcccatgcgcagccgtttcagcctggacgaatgccatgcc
gacatcgaggcctgcttcaaccaggttgtgaacgcgggtgtgattccgctggctgtgggc
ggtgaccattcgatcacgggctccatcctgaaagcggtgggacgcgaccggccggtgggc
atggtgcatattgatgcccactgtgacaccgccggaacctacgagggctccaaatttcac
cacggcgggccctttcgggaagcggtgctggccggcgtgctggatccgcgccgctgcatc
cagattggcattcggggcggggccgagtatttgtgggagttttcgtttgactccggaatg
accgtcatccatgccgaagagttctccaaaatgggcgtggaagccgtgatccggcgcgcc
cgcgaagtggtgggcgacggcccgacctatgtgacgtttgacgtggacagcctggacccc
gcgtatgcgccgggcacgggcacgcccgaggtcggcggcctgagcccgcgcgaagtgctc
accttgctgcgcggcctggcgggcctgaacattgtcggcggtgacgtgatggaggtcgct
ccacagaacgacccctccggcaacacggccctggtgggcgcgcagatgctgttcgagata
ctgtgcctggttgcattgtcgccagccatggcgaaccgataa

DBGET integrated database retrieval system