KEGG   Polaromonas sp. JS666: Bpro_2049Help
Entry
Bpro_2049         CDS       T00343                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pol  Polaromonas sp. JS666
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pol01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pol00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pol00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pol00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:pol00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2129728..2131725
Genome map
AA seq 665 aa AA seqDB search
MSSAPSNIESVLVENRVFPPGPATVKAARISGMEAYNAMCREADKDFDRFWARLARDNLS
WKKPFSQVLDESNAPFYQWFADGELNASYNCLDRHLGTPTESKKAIIFESDDGKATSVTY
KELHARVSQFASALKGLGVKKGDRVIIYMPMTIEGVVAMQACARIGATHSVVFGGFSAKS
LQERIQDAGAVAVITANYQLRGGKELPLKAIVDEGIAMGGCESIKNVVVYQRTATPCNMV
AGRDSLMHEITARAAATCEPEFVGAEHPLFILYTSGSTGKPKGVQHSTGGYLLWAKLTMD
WTFDIQPADVFWCTADIGWITGHTYVAYGPLAAGATQVIFEGIPTYPNAGRFWQMIEKHK
VTIFYTAPTAIRSLIKAAEGDEKIHPARSDLSSLRILGTVGEPINPEAWMWYYKNIGGER
CPIVDTFWQTESGGHMITPLPGATPLVPGSCTLPLPGIMAAIVDETGKDLPNGSGGLLVV
KRPWPSMIRGIWNDPERFKKSYFPEEMGGTMYLAGDGAVRNADNGYFRITGRIDDVLNVS
GHRMGTMEIESALVAHSTLVAEAAVVGRPDDLTGEAIVAFVVLKRSRPTGDEAKAIAKEL
RDWVGKEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRGIAKGEALTQDTSTLENPAILDQ
LSENL
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgagttccgccccgtcgaacatcgagtccgtgctggttgaaaaccgcgtatttcccccc
gggccggctaccgtcaaggccgcccgcatttccggcatggaggcttacaacgcgatgtgc
cgggaggccgacaaggattttgaccgcttctgggccaggctggccagggacaatctcagc
tggaaaaaacctttcagccaggttctggacgagtccaatgcaccgttttaccaatggttt
gccgatggtgaactgaacgcctcctacaactgcctggaccgccacctgggtacgccgaca
gagagcaagaaggccattattttcgagagcgatgatggcaaggcgaccagcgtcacttat
aaggaactgcatgccagggtcagtcagtttgccagtgcgctcaagggcctgggggtgaag
aagggcgaccgcgtcatcatctacatgccaatgaccattgaaggcgttgttgccatgcag
gcctgtgcccgcattggtgccacgcactcggtggtgttcggtggtttctcggccaagagc
ctgcaggagcgcatccaggacgccggtgcagtcgcagtcattaccgccaactaccagttg
cgcggcggcaaggagctgccgctcaaggcgattgtggacgaaggcatcgccatgggcggc
tgcgagtcgatcaagaacgtggtggtctaccagcgcaccgccacgccctgcaacatggtg
gccgggcgcgacagcctgatgcacgagatcaccgccagggccgcagccacctgcgagccg
gaatttgtgggcgccgagcatccgctgttcatcctgtacacgtcgggctccaccggcaag
cccaagggcgtgcagcacagcacgggcggctacctgctgtgggccaagctcaccatggac
tggacctttgacatccagcccgccgatgtgttctggtgcaccgccgacatcggctggatc
accggccacacctatgtggcgtatggcccgctggccgctggtgcgacgcaggtcatcttt
gaaggcattccgacttacccgaacgccggccggttctggcagatgatcgagaagcacaag
gtcacgattttttacacagcacccaccgccatccgttcactgatcaaggccgctgaaggc
gatgaaaaaatacacccggcccgctcggatctgagcagcctgcgcattctgggcacggtg
ggcgaacccatcaaccccgaggcctggatgtggtactacaaaaacattggtggcgagcgc
tgcccgattgtggataccttctggcaaaccgagtcgggcggacacatgatcacgccgctg
cccggcgcgacgccgctggttcctggcagctgcaccttgccgctgcccggcatcatggcc
gccatcgtcgacgaaaccggcaaggacttgcccaacggctcgggcggcctgctggtggtc
aaacgcccgtggccgtccatgattcgcggcatctggaatgaccccgagcgcttcaagaag
agctactttccggaagaaatgggcggcacgatgtacctggccggcgacggcgcggtccgc
aatgctgacaacggctatttccgcatcaccggccggattgacgatgtgctgaatgtgtcg
ggccaccgcatgggcaccatggaaatcgaatcggcactggtggcgcactcgaccctggtg
gcggaggctgccgtggtaggccgccctgatgacctgaccggcgaggcgatcgtggcgttt
gtggtgctcaagcgctcgcggcccacgggcgatgaggccaaggcgattgccaaggagctg
cgcgactgggtcggcaaggagattggcccgattgccaagcccaaggacatccggtttggt
gacaacctgcccaagacgcgcagcggcaaaatcatgcgccgcctgttgcgcggcattgcc
aagggtgaggctcttacgcaggacacctcgacgctggagaatccggcgatcctcgatcag
ttgtctgaaaacctctga

DBGET integrated database retrieval system