KEGG   Polaromonas sp. JS666: Bpro_2091Help
Entry
Bpro_2091         CDS       T00343                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
pol  Polaromonas sp. JS666
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pol00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:pol00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2177514..2179091
Genome map
AA seq 525 aa AA seqDB search
MSAADWLTRSVSKLRVVPDAGAKMSSEKSPNSAAESTAPATPKASTTPTAPTAPKASPAP
AARAGVPAAGDARTPPPVAGRSTRERLNATLRHKEEALSPRVLRRTLEELKAIVDPQVSE
VEGGRRAKGVAGWYAGAALNERRDMWLLMSEQFVADAQKVKLAQAQFAAAVGTPDEAVAE
VRYRRATVSPRRRLLQRFSAFPEGIRFLVDLRADMLPYLKADKRLQALDVEMEYMFSTWF
DVGFLDLRRISWDSPASLIEKLIKYEAVHDIKSWADVKNRLDSDRRCYGFFHPRLPDEPL
IFVEVALIDAMSHSITPLLDESADAVDVNKATTAIFYSISNTQAGLRGVSFGDSLIKRVV
ETLKEEFPRLRTFATLSPIPGFRSWLAKNAGAMLESLGEKDRVALGRAVGFEPPGVGHFL
SAAEGALTLHEKSPVRLMLLRCAAHYLGRALDDGKPLDAVARFHLGNGARIERLNWAGDP
SPKGLKQSYGLMVNYLYDLKRLDKHRAMLAQGKIPVSGEVEDLYI
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgccgactggctcactcgaagtgtttccaagttgcgggttgtgcccgacgcc
ggagcgaaaatgtcatccgaaaaatcaccaaactccgctgccgagtccacggcgccagca
acaccaaaagcatcgacaacaccaacagcgccaacggcgccgaaggcctctccggcgcct
gctgcgcgggccggtgtgccggcagcgggcgatgcccgaaccccgcccccggttgccggc
cgttcgacccgagagcggcttaatgccacgctgcggcacaaggaggaggcactctcgccg
cgcgtcttgcgccggacgctggaggagctgaaggcgatcgtggatccgcaggtcagcgag
gttgaaggcgggcgccgagccaagggtgttgccggctggtatgccggcgccgccttgaat
gagcggcgcgacatgtggctcctgatgagcgagcagtttgttgccgacgcccagaaggtc
aagctcgcacaagcccagtttgccgccgccgtcggaacgcctgacgaggccgttgccgag
gtgcgctatcgccgtgccacggtgtcaccgcgcagacgcctgctccagcgcttcagcgcg
ttcccggaaggcatccgctttctggtggatttgcgagccgacatgctgccctacctgaag
gccgacaagcgcctgcaggcgctggatgtcgagatggagtacatgttctccacctggttc
gacgtcggcttccttgacctgcgccgcatcagctgggattccccggcatccctgattgaa
aaactgatcaagtacgaggcggtgcacgacatcaagagctgggccgatgtgaagaaccgg
cttgactctgaccgccgctgctatggcttcttccatccgcgcctgcccgacgagccgctg
atatttgtggaagtcgcgttgatcgatgccatgtcccacagcatcacgccgctgctggac
gagtcggccgacgcggtggacgtgaacaaggcgaccacggcgattttttattccatcagc
aacacacaggctggtttgcgcggcgtgagctttggcgactccctgatcaagcgggttgtg
gagaccctgaaggaagagtttccgcggctcaggacgtttgccacgctctcgccgattccg
ggcttcaggagctggcttgccaagaacgctggcgccatgctggagagcctgggcgagaag
gatagggtggcgctgggccgtgccgtggggtttgagccgccgggggttgggcattttctc
agcgctgcagagggtgccctgaccttgcatgaaaaatcaccggtgcgactgatgctgctg
cgatgcgctgcgcattacctgggccgtgctctggatgacggcaaaccgctcgatgcggta
gcgcgctttcacctcggcaatggcgcccgtattgaacggctcaactgggcaggagatcct
tcgcccaaagggctcaagcagtcgtatggcctgatggtgaattacctctacgacctcaag
cgcctggacaagcaccgcgccatgctggcacaggggaaaatccccgtatcaggggaggtc
gaagatttgtacatttga

DBGET integrated database retrieval system