KEGG   Polaromonas sp. JS666: Bpro_2101Help
Entry
Bpro_2101         CDS       T00343                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00630  Glyoxylate and dicarboxylate metabolism
pol01100  Metabolic pathways
pol01110  Biosynthesis of secondary metabolites
pol01120  Microbial metabolism in diverse environments
pol01200  Carbon metabolism
Module
pol_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bpro_2101
Enzymes [BR:pol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Bpro_2101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABE44028
JGI: Bpro2101
UniProt: Q12BR4
Position
2189167..2190486
Genome map
AA seq 439 aa AA seqDB search
MPQTLTEQLSRDQQISALEKDWATNPRWKGIKRGYSAADVVRLRGSFPIEHTLARRGAEK
LWNILHSEPYVNCLGALTGGQAMQQVKAGVKAIYLSGWQVAADNNTYSAMYPDQSLYPVD
SVPKVVETINNTFRRADEIQHSKGIDAGDKGYIDYFAPIVADAEAGFGGVLNAFELMKAM
IKAGAGGVHWEDQLASVKKCGHMGGKVLLPTRESCQKLIAARMAADVCGVPTLVIARTDA
EAADLLTSDYDEIDKPFLTGERTAEGFYKTRKGLEQAVARANAYAHYADLVWCETGTPDL
DFARKFADAVHKVHPGKMLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKYQFITLAGI
HSMWYNMYDLSQDYVKRGMTAYIEKVQEPEFAARDRGYTFVSHQQEVGTGYFDEVTTAIQ
GGKSSVTALTGSTEEEQFH
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgccacagaccctcactgaacaattgagccgcgaccagcagatttccgccctcgaaaaa
gactgggccaccaacccgcgctggaaaggcatcaagcgcggctacagcgccgccgacgtg
gttcgcctgcgtggctcgttcccgatcgaacacacgctggcccgccgtggtgccgaaaag
ctgtggaacatcctgcacagcgagccttatgtcaactgcctgggcgcgctcaccggcggt
caggccatgcagcaggtcaaggccggcgtgaaggccatctacctgtcgggctggcaggtt
gccgctgacaacaacacctactcggccatgtacccggaccagtcgctgtacccggtggac
tcggtgcccaaggtggtggaaaccatcaacaacactttccgccgtgccgacgaaattcag
cactccaaaggcattgatgccggcgacaaaggctacatcgactatttcgcccccatcgtt
gcagacgctgaagccgggtttggcggcgtgctcaatgcttttgagctgatgaaggccatg
atcaaggccggggccggcggcgtgcattgggaagaccagctggcgtccgtcaagaagtgc
ggccacatgggcggcaaggtgctgctgccgacgcgcgagtcctgccagaaactgatcgcc
gcgcgcatggcggccgacgtgtgcggcgtgcctaccctggtgattgcacgtaccgacgcc
gaggcagccgacctgctgacctccgactatgacgagatcgacaagcctttcctgacgggt
gagcgcaccgccgaaggtttctacaagacccgcaagggcctggagcaggctgttgcccgc
gccaacgcctatgcgcattacgccgatctggtgtggtgtgaaaccggcacgcctgacctt
gacttcgccaggaagtttgccgatgccgtgcacaaggtccaccccggcaagatgctggcc
tacaactgctcgccttcgttcaactggaagaagaacctggacgatgccaccatcgccaag
ttccagcgcgaactcggcgcgatgggctacaagtaccagttcatcacgctggctggcatt
cactccatgtggtacaacatgtacgacctgtcgcaagactacgtcaagcgcggcatgacg
gcctacatcgagaaggtgcaggaacccgagttcgcagcgcgtgaccgcggctacaccttt
gtgtcgcaccagcaggaagtgggcaccggttatttcgatgaagtgaccacggcgatccag
ggcggcaagtccagcgtgaccgcattgaccggctctaccgaagaagagcagttccattga

DBGET integrated database retrieval system