KEGG   Polaromonas sp. JS666: Bpro_2169Help
Entry
Bpro_2169         CDS       T00343                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
pol  Polaromonas sp. JS666
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Bpro_2169
Enzymes [BR:pol01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Bpro_2169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2263008..2264045
Genome map
AA seq 345 aa AA seqDB search
MDLSRFPRRRYTQGPTPLEFLPHFTEALRATCPEGSGPNIWIKRDDMLGLTPGGNKTRKL
EFLAADALAQGADTLITCGAPQSNHCRATLCAAIKEGLKCRFVIEERVPNSYRENASGNN
FLFRLLGVEAITVVPAGTNMMEAMQKVAADLAKEGRKGYIVPGGGSNAIGGLGYVACAQE
LQQQFFEQGVQIDKIVVGSGSSGTHGGLLAGFLGNHIHIPLIGIGVSRDPVDQDPLVHKE
AQAVADLLGLNMTIPREAVVSYGDWWRPKYSVPNQAMVEAVQMLARTEAILLDPVYTGKI
MAGLIGLARKGHFRRDENVLFIHTGGAPSLHAYEAEVLGLTELPA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggacctgagccgctttcctcgtcgccgttacacccaggggccgaccccgctggagttc
ctgccccacttcactgaagcactccgcgccacctgccccgagggcagcggccccaatatc
tggatcaaacgcgacgacatgctgggcctgacgcccggcggcaacaagacgcgcaagctg
gagttcctggctgctgacgcactggcccagggtgccgacacgctgataacctgcggcgcg
ccacagtccaaccactgccgcgccacactgtgcgcggccatcaaggaagggctcaaatgc
cgcttcgtgattgaagaacgggtgcccaacagctaccgggaaaatgccagcggcaacaac
tttcttttccgcctgctgggcgtcgaggccatcaccgtcgtgcctgcgggcaccaacatg
atggaggccatgcagaaagtcgccgccgacctggccaaagaaggccgcaagggctacatc
gtgccgggcggtggttccaacgccattggcggtctgggttatgtggcctgcgcgcaggag
ctgcagcagcagtttttcgagcagggcgtgcagatcgacaagatcgtcgtgggctcgggc
agctcgggcacgcacggtggcctgctggccggcttcctgggcaaccacatccatattccc
ctgatcggcattggtgtgagccgcgacccggtggaccaggatcccctcgtgcacaaggag
gcccaggccgtggccgacctgctgggcctgaatatgaccattccgcgcgaagcggtcgtg
agctatggcgactggtggaggcccaagtattcggtacccaaccaggccatggtcgaagcc
gtgcagatgctggcgcgcaccgaggccattctgctggacccggtgtacaccggcaagatc
atggccgggctgatcggactggcgcgcaaaggccatttccgccgtgatgaaaacgtgctg
ttcattcacaccggaggggcaccgtcgctgcatgcctacgaagccgaggtgctgggcctg
accgagctgccggcctga

DBGET integrated database retrieval system