KEGG   Polaromonas sp. JS666: Bpro_2191Help
Entry
Bpro_2191         CDS       T00343                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pol  Polaromonas sp. JS666
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bpro_2191
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bpro_2191
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bpro_2191
Enzymes [BR:pol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bpro_2191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2286979..2288409
Genome map
AA seq 476 aa AA seqDB search
MMRYISTRAASGDMADRKRFCEILLEGLAPDGGLYLPERYPQVDDATLTKWRGLSYGDLA
FEVLSLYVDDIPPADLKAICEKTYTEEVFGTKEIVPLKKLQEGLYLEALSNGPTLAFKDM
AMQLLGNLFEYELARRGEELNILGATSGDTGSAAEYAMRGKKGVRVFMTSPNGRMSPFQQ
AQMFSLQDPNIHNLALEGVFDDCQDIVKAVSNDLDFKRQYKIGTVNSINWARLMAQVVYY
FAGYFEATTSNTEKVSFTVPSGNFGNVCAGHVARMMGLPIAKLVVATNENDVLDEFFRTG
VYRVRAGADTHETSSPSMDISKASNFERFVFDLLGRDATRIAELFGNRLSAQGSFDLSGD
AAFQAAAQRYGFASGTSTHADRLQTIRDTFQRLGTMIDTHTADGLKVARTHLQVGVPMIV
LETALPIKFAETIEEALGRLPTRPAKFEGIEDLPKRVQVMPADVDLVKAYIANNVH
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgctacatctccacccgcgccgcatccggcgatatggctgaccgcaagcgcttt
tgcgaaatcctgcttgaaggtctggcgcctgatggcggtttgtacctgccggagcgctat
ccgcaggtggacgacgcgacgctgacgaaatggcgcggcctgtcctatggcgaccttgcg
tttgaagtcctgtcgctctatgtcgacgatattccgccggcggacctgaaggcgatctgc
gagaagacctataccgaagaggtttttggaacgaaagagatcgttccgctgaaaaaactg
caagagggcctgtacctcgaagccctctcgaacggccccacactcgccttcaaggacatg
gccatgcaattgctgggcaacctgttcgagtacgaactggcccgccgcggcgaagagctg
aacatcttgggggccaccagcggcgataccggcagtgcggccgaatacgcgatgcgcggc
aaaaagggcgtgcgggttttcatgacctcgccgaatggccgcatgagcccgttccagcag
gcgcagatgttcagcctgcaggacccgaacatccacaatctcgcgctggaaggcgtgttt
gatgactgccaggacatcgtcaaggcggtgtccaatgacctggatttcaagcgccagtac
aagattggcacggtcaattccatcaactgggcgcgcttgatggcgcaggtggtgtattac
ttcgccggctatttcgaagccacgacatcgaacaccgaaaaagtcagctttaccgtgccg
tcgggcaacttcggcaatgtctgcgccggccatgtggcccgcatgatgggtttgcccatt
gccaagctggtggtggcgaccaacgagaacgacgtgctggacgaattctttcgcaccggg
gtctaccgcgtgcgggccggcgccgacacgcatgagacctccagcccgtcaatggacatt
tccaaagcctcgaacttcgagcgttttgtgttcgacctgctgggccgggacgcgacgcgc
atcgccgaactgttcggaaaccggttgtcggcacagggcagttttgacctgagcggcgat
gccgccttccaggcagccgcgcagcgctacgggtttgccagcggcacgagcacccacgcc
gaccggttgcagacgattcgcgacaccttccagcgcctgggtaccatgatcgatacgcat
accgccgacggcctgaaggtggcgcgtacgcacctgcaggtgggtgtgcccatgatcgtg
ctcgagacggccctgccgatcaagttcgccgaaaccatcgaagaggcgttgggccgcttg
ccgacccggcccgcaaagttcgaaggcatagaggacttgcccaagcgtgtgcaggtcatg
cccgccgatgttgacctggtcaaggcctatatcgccaacaatgtgcattga

DBGET integrated database retrieval system