KEGG   Polaromonas sp. JS666: Bpro_2205Help
Entry
Bpro_2205         CDS       T00343                                 

Definition
PfkB protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pol  Polaromonas sp. JS666
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bpro_2205
Enzymes [BR:pol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Bpro_2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2301990..2302973)
Genome map
AA seq 327 aa AA seqDB search
MSHPDSPAGAAEPVAITATEAPAEVVCVASWNADLVSHVARPIARGETLMASAFSISPGG
KGSNAAVAAARQGARVALIARIGDDDFGRMGMTLWHAEGVATDHVEHAAGECSGVAQILV
YDDGDNSIAVCPGAGSGLGASQVQAAHGVLRSCRVVMASCEVPVEATLQAFRLAREAGAI
TLLNPAPARPLPEELLALVDVLTPNESELYQLAGAEHSGSLDAAANHLLAGGTGAVLVTL
GAAGCRLYQGRQTPIGLAGRSMPVLDTIGAGDTFTGTLAAALARGEPLASAMQWANAAAA
LSVTRRGAIDGIPARADVAALMSQVAR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgagccacccggatagccccgccggcgccgcagagcccgtagcaataacagccaccgaa
gcgcctgccgaggtggtctgcgtggccagctggaatgccgacctggtgtcgcacgtggca
cggcctatcgctcgcggcgagacgctgatggccagtgcattcagcatcagccccggcggc
aaaggcagcaatgcggccgtcgctgccgcccgccagggcgcgcgcgtagcgctcatcgcc
cgcatcggcgacgacgacttcgggcgtatgggcatgacgctgtggcatgccgaaggcgtc
gccaccgaccatgtcgagcacgccgccggcgaatgcagcggcgtggcccagatcctggtg
tatgacgatggcgacaacagcattgctgtctgccccggcgccggctccggcctgggcgca
tcgcaggtacaggcggcccatggtgtgctgcgcagctgccgcgtcgtgatggcgtcctgc
gaggtgcctgtagaggccacgctgcaggccttccggctggcccgcgaagccggggccatc
accctgctgaaccccgcgccggcacgtcccctgcctgaggagttgctggcactggtcgac
gttctcacgccgaacgaaagcgagctgtatcagctcgccggtgcggagcactcaggatcg
ttggacgccgccgcaaatcacctgctggcaggcggaaccggtgcggtgctggtgacgctg
ggcgctgccggctgtcgcctttatcaaggcagacagaccccgatcggcctggccggacgc
agcatgcccgtgctggacaccataggcgcaggcgacaccttcaccggtacgctggcagcg
gccctggcacgcggcgagccactcgcgagcgccatgcaatgggccaatgccgcggcggcc
ctgtcagtgaccaggcgtggcgcgatcgacggcattccggcacgcgcagacgttgcggcc
ctgatgagccaggtcgccaggtaa

DBGET integrated database retrieval system