KEGG   Polaromonas sp. JS666: Bpro_2409Help
Entry
Bpro_2409         CDS       T00343                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pol  Polaromonas sp. JS666
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bpro_2409
   00240 Pyrimidine metabolism
    Bpro_2409
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Bpro_2409
   03430 Mismatch repair
    Bpro_2409
   03440 Homologous recombination
    Bpro_2409
Enzymes [BR:pol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Bpro_2409
DNA replication proteins [BR:pol03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Bpro_2409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2508011..2508448
Genome map
AA seq 145 aa AA seqDB search
MTEIAFHFNVPDKLAYGCRLLRKAYLSGASVVVTAEADVLAQLDQSLWSFSPTEFVPHCR
SDAGEDNLAVTPVLLAESLQDCARHEVLVNLGQGIPAGFERFERFIEVVAQGDDERLAAR
SRWKHYTDRGYTMKRHDLATAKGGA
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatcgcctttcatttcaacgtacccgacaagctggcctacggttgccgtttg
ctgcgcaaggcgtatctcagcggcgccagcgtggtggtgacggccgaggccgatgtgctg
gcgcagcttgatcaatcgctgtggagcttttcccctacggaattcgtaccgcattgccgc
agcgatgccggggaggacaacctcgccgtgacaccggtattgcttgccgagtcgctgcag
gactgcgcccgtcatgaggtgctggtcaatctggggcagggcattcctgcgggatttgag
cgctttgagcgcttcatcgaggtggttgcgcagggtgacgatgagcgtctggccgcgcgc
agccgatggaagcattacaccgacaggggttacaccatgaagcgacacgaccttgcaacg
gccaagggaggcgcatga

DBGET integrated database retrieval system