KEGG   Polaromonas sp. JS666: Bpro_2467Help
Entry
Bpro_2467         CDS       T00343                                 

Definition
response regulator receiver (CheY-like protein) modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pol  Polaromonas sp. JS666
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pol02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pol02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2576278..2577387
Genome map
AA seq 369 aa AA seqDB search
MTDGKINVLVAEDSAIARVLLVRLLESDPLIRVVGAVGDGQAAIDFVNHNKPDVVLMGVH
MPRLDGFETTRRIMETQAVPIIICSASNNVTDIAVTFRAMEAGAIACIEKPFTGEQDDFE
AMAAHLLETVKLMSEVKVVRRTAHRRPAPLPSAYPPAPAAQRQRAPAQIKLVGIGASTGG
PLALQTILSGLPKDFPAPVLVVQHIAHGFLPGMAEWLNQTTTLQIHIASYGTTPLPGHVY
LAPDDFHMGIGTGGNIILTREAPENHLRPAVSFLFRSLAETYGPNALGVLLTGMGKDGAE
ELKAMMAKGAVTIAQDQESSVVHGMPGVAIALGAATQVLPADKIADALIALVRQIDGDGD
GHGHGIAGD
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatggcaagatcaacgtactggtggcggaagactcggcgatcgcacgcgtgctt
ctcgtgcgcctgctcgaatcggatccgctgattcgcgttgtcggcgccgtcggtgacggc
caggcggcaatcgatttcgtcaatcacaacaagcccgatgtcgtactcatgggcgttcat
atgccacggcttgatggtttcgagacgacgcgccgcatcatggaaacgcaggcggtgcca
atcatcatctgcagcgccagcaacaacgtcaccgatatcgccgtgacgttccgcgccatg
gaagccggagccatcgcctgcattgaaaaaccttttactggcgagcaagacgacttcgag
gcgatggcggcgcacctgctggaaacggtcaagctgatgtccgaggtcaaggtcgtgcgc
cgcacggcccacaggcggccggcgccattgccttcagcctatcctccggccccagccgcg
cagcggcagcgcgctccagcgcagatcaaactcgtcggcatcggcgcgtccaccggtgga
ccgctggcgctgcaaaccatcctctcaggtttgccaaaggactttcccgcgccggtgctc
gtcgtgcagcacattgcgcacggttttctgcccggaatggccgagtggctgaaccagacc
accactttgcagattcatatcgcctcctacggtacaaccccgctgccgggtcatgtctac
ctggcgccggacgatttccacatgggcatcggcaccggtggcaacatcatcctgacccgg
gaggcaccggagaatcacctgcggccggccgtatccttcctgttccgctcgctggcagaa
acatacggcccgaacgcactgggcgtgttgctgacgggcatgggcaaggacggtgccgag
gaactgaaggcgatgatggccaaaggggctgtcaccatcgcacaagaccaggaaagctcg
gtggtgcatggcatgccgggtgttgccattgccctgggcgccgccacacaggtgttaccg
gccgacaagatcgccgatgcgctgatcgcgctggtcaggcaaattgatggcgatggcgat
ggtcatggtcatggaatagcgggggactga

DBGET integrated database retrieval system