KEGG   Polaromonas sp. JS666: Bpro_2623Help
Entry
Bpro_2623         CDS       T00343                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pol  Polaromonas sp. JS666
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bpro_2623
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bpro_2623
  Amino acid metabolism
   00310 Lysine degradation
    Bpro_2623
Enzymes [BR:pol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bpro_2623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2754370..2755638)
Genome map
AA seq 422 aa AA seqDB search
MAIVEVKVPQLSESVAEATMLQWKKKIGEAIAIDEILIEIETDKVVLEVPAPSAGVLTEL
VVADGGTVVSDQVIARIDTEGKAGAGAPAPAAAAAAAPAAAASSVPAPAAGGSMAGVPMP
AAAKLMADANLAAGSVPGTGKDGRVTKGDVLGATAAGAVKSVAASPVPTGAPTTSLPQVA
AQVKPADLGDRPEQRVPMSRLRARVAERLLQSQSTNAILTTFNEVNMAPVMEMRKRFQEK
FEKEHGVKIGFMSFFVKAAVHALKKYPVLNASVDGNDIVYHGYFDIGIAVGSPRGLVVPI
LRNADQMSFADIEKKIAEYGAKARDGKLGIEEMTGGTFSISNGGVFGSMLSTPIINPPQS
AILGVHATKDRAVVENGQIVVRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPARLLF
DI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccaattgtccgagtccgtggcggaagccaccatg
ctgcagtggaaaaagaaaatcggcgaggcaattgccatcgacgaaatcctgattgaaatc
gaaaccgacaaggtcgtgctggaagtgcccgcgccttcggccggtgtgctgaccgagctg
gtggtggccgatggcggcaccgtggtgtccgaccaggtgattgcgagaattgataccgag
ggcaaggcaggcgctggtgcgccggctccagcggcggcagcggccgctgctcctgcagct
gcagcttcatctgtgccggcccctgcggcgggtggttccatggccggtgtgcccatgccg
gctgctgccaagctgatggcggacgccaacctggcggccggctctgtgcctgggaccggc
aaggacggccgtgtcaccaagggtgatgtgctcggcgcaacagcagccggtgctgtcaaa
tctgtagctgccagcccagttcctacgggggctccgaccacttccttgcctcaggtcgcc
gcgcaggtgaagcccgctgacctgggcgatcgtcccgagcagcgtgtgcccatgagccgc
ctgcgtgcgcgcgtggccgagcgcctgttgcagtcccaatccaccaacgccatcctcact
accttcaatgaagtgaacatggctcccgtgatggaaatgcgcaagcgattccaggagaaa
ttcgagaaggagcatggcgtcaagatcggcttcatgagcttttttgtgaaggccgcagtg
catgcgttgaagaagtacccggtcctgaacgcgtcggtcgacggtaacgacatcgtctac
cacggctacttcgacatcggtattgctgtcggttcaccgcgcggcctggtggtgcccatc
ctgcgcaatgccgaccagatgagctttgccgacatcgagaagaagatcgccgaatatggt
gccaaggcgcgcgatggcaagctgggcatcgaagagatgacgggtggtaccttctcgatc
tccaacggcggtgtgttcggctccatgctgtccacgcccatcatcaacccaccgcagtcc
gccattctgggcgtgcacgccacgaaagaccgggcagtcgtcgagaacggccagattgtg
gttcgcccgatgaactacctggccatgagctatgaccaccgcatcattgatggccgcgaa
gccgtgctgggcctggtggccatgaaggaagcgctggaagatccggcccgcttgctgttt
gatatttga

DBGET integrated database retrieval system