KEGG   Polaromonas sp. JS666: Bpro_2623Help
Entry
Bpro_2623         CDS       T00343                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00020  Citrate cycle (TCA cycle)
pol00310  Lysine degradation
pol01100  Metabolic pathways
pol01110  Biosynthesis of secondary metabolites
pol01120  Microbial metabolism in diverse environments
pol01130  Biosynthesis of antibiotics
pol01200  Carbon metabolism
Module
pol_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pol_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bpro_2623
  Amino acid metabolism
   00310 Lysine degradation
    Bpro_2623
Enzymes [BR:pol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bpro_2623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABE44539
JGI: Bpro2623
UniProt: Q12AA3
Position
complement(2754370..2755638)
Genome map
AA seq 422 aa AA seqDB search
MAIVEVKVPQLSESVAEATMLQWKKKIGEAIAIDEILIEIETDKVVLEVPAPSAGVLTEL
VVADGGTVVSDQVIARIDTEGKAGAGAPAPAAAAAAAPAAAASSVPAPAAGGSMAGVPMP
AAAKLMADANLAAGSVPGTGKDGRVTKGDVLGATAAGAVKSVAASPVPTGAPTTSLPQVA
AQVKPADLGDRPEQRVPMSRLRARVAERLLQSQSTNAILTTFNEVNMAPVMEMRKRFQEK
FEKEHGVKIGFMSFFVKAAVHALKKYPVLNASVDGNDIVYHGYFDIGIAVGSPRGLVVPI
LRNADQMSFADIEKKIAEYGAKARDGKLGIEEMTGGTFSISNGGVFGSMLSTPIINPPQS
AILGVHATKDRAVVENGQIVVRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPARLLF
DI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccaattgtccgagtccgtggcggaagccaccatg
ctgcagtggaaaaagaaaatcggcgaggcaattgccatcgacgaaatcctgattgaaatc
gaaaccgacaaggtcgtgctggaagtgcccgcgccttcggccggtgtgctgaccgagctg
gtggtggccgatggcggcaccgtggtgtccgaccaggtgattgcgagaattgataccgag
ggcaaggcaggcgctggtgcgccggctccagcggcggcagcggccgctgctcctgcagct
gcagcttcatctgtgccggcccctgcggcgggtggttccatggccggtgtgcccatgccg
gctgctgccaagctgatggcggacgccaacctggcggccggctctgtgcctgggaccggc
aaggacggccgtgtcaccaagggtgatgtgctcggcgcaacagcagccggtgctgtcaaa
tctgtagctgccagcccagttcctacgggggctccgaccacttccttgcctcaggtcgcc
gcgcaggtgaagcccgctgacctgggcgatcgtcccgagcagcgtgtgcccatgagccgc
ctgcgtgcgcgcgtggccgagcgcctgttgcagtcccaatccaccaacgccatcctcact
accttcaatgaagtgaacatggctcccgtgatggaaatgcgcaagcgattccaggagaaa
ttcgagaaggagcatggcgtcaagatcggcttcatgagcttttttgtgaaggccgcagtg
catgcgttgaagaagtacccggtcctgaacgcgtcggtcgacggtaacgacatcgtctac
cacggctacttcgacatcggtattgctgtcggttcaccgcgcggcctggtggtgcccatc
ctgcgcaatgccgaccagatgagctttgccgacatcgagaagaagatcgccgaatatggt
gccaaggcgcgcgatggcaagctgggcatcgaagagatgacgggtggtaccttctcgatc
tccaacggcggtgtgttcggctccatgctgtccacgcccatcatcaacccaccgcagtcc
gccattctgggcgtgcacgccacgaaagaccgggcagtcgtcgagaacggccagattgtg
gttcgcccgatgaactacctggccatgagctatgaccaccgcatcattgatggccgcgaa
gccgtgctgggcctggtggccatgaaggaagcgctggaagatccggcccgcttgctgttt
gatatttga

DBGET integrated database retrieval system