KEGG   Polaromonas sp. JS666: Bpro_2641Help
Entry
Bpro_2641         CDS       T00343                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pol  Polaromonas sp. JS666
Brite
Enzymes [BR:pol01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Bpro_2641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 Methyltransf_11 CMAS Methyltransf_32 Methyltransf_12 Methyltransf_4 Methyltransf_PK NodS Ubie_methyltran MTS DREV Methyltransf_23 GCD14 Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: ABE44557
JGI: Bpro2641
UniProt: Q12A85
Position
complement(2781248..2781958)
Genome map
AA seq 236 aa AA seqDB search
MNVSVPLPSGGTMTEPDFSVLRQSMIAEIAAKTAFVSTQLGKAVLDPRVMNAMAKVPRHE
FVLLELRPYAYADTPLPSCFDKTISQPFIVAVMTDLLELRPTDTVLEIGTGLGYQTAILA
ELAQHVYSIEIIEEMAVQARQRLARHGYTNVDIKIGNGCGGWPEHAPFDKVIVTAAPDLI
PPPLIYQLKPGGKMVIPAGLPNDQQLILVEKDASDAVSTRDILPVRFSLLEDAEPG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgtccgtgccacttccttcaggaggcaccatgaccgaaccggacttctctgtc
ctgcgccagtccatgatcgcggaaatcgccgccaagacagcttttgtcagcacgcagttg
ggcaaagcggtgctggatccgcgggtcatgaacgccatggccaaggtgccgcgccacgag
ttcgttctgctcgaactgcggccctacgcctacgccgacacgcccctgccaagctgcttc
gacaagacaatctcgcagccgttcatcgtcgcagtaatgaccgacctgcttgagctgcgc
ccgaccgacacggtcctcgagatcggcaccgggcttggttaccagacagccatcctggcg
gaacttgcgcagcacgtttacagcattgaaatcattgaagagatggctgtgcaggctcgg
caacggctggcccgacacggttataccaacgtcgatatcaagattggcaacggctgcggc
gggtggcccgaacacgcgccgttcgacaaggtgatcgtcacggcggcgcccgatctgatc
ccgccaccgctcatctaccagttgaaacccggcggcaagatggtgatacccgccggtctg
cccaacgatcagcaactcatcctggtcgagaaagacgccagcgatgcggtatcgaccagg
gatatcctgccggtgcggttctcgctgctcgaggatgccgagcccggctga

DBGET integrated database retrieval system