KEGG   Polaromonas sp. JS666: Bpro_2671Help
Entry
Bpro_2671         CDS       T00343                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00010  Glycolysis / Gluconeogenesis
pol00020  Citrate cycle (TCA cycle)
pol00620  Pyruvate metabolism
pol01100  Metabolic pathways
pol01110  Biosynthesis of secondary metabolites
pol01120  Microbial metabolism in diverse environments
pol01130  Biosynthesis of antibiotics
pol01200  Carbon metabolism
Module
pol_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bpro_2671
   00020 Citrate cycle (TCA cycle)
    Bpro_2671
   00620 Pyruvate metabolism
    Bpro_2671
Enzymes [BR:pol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bpro_2671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H PYNP_C HlyD_D23 NQRA RnfC_N HlyD_3
Motif
Other DBs
NCBI-ProteinID: ABE44587
JGI: Bpro2671
UniProt: Q12A55
Position
complement(2806853..2808523)
Genome map
AA seq 556 aa AA seqDB search
MAVVDIQVPDIGDFDEVTVIELLVKPGDTVKAEQSLITVESDKASMEIPSSQAGVVKELK
VKLGDKVKQGSIVLTVEAAGAAVPATASAAAASAAPAASTAAAPAPAPAPAPVPASAPAA
AAGPVEVRVPDIGDFKDVSVIEVLVKPGDTIKLEQSLVTVESDKASMEIPSSAAGVLKEL
KVKLGDIVNIGDLLAILEGSVAATGTSPAPAPAAPAAAPAPVSAAAAAPAAAVMPAHEPA
TAQQGSLPHASPSVRKFARELGVPLAEVKGTGPKGRITQDDVQAFTKSVMAGDTRTQAQA
AKAPASSGGTGVGLDLLPWPKVDFTKFGPVERKDMSRIKKISGANLLRNYVMIPHVTNHD
DADITELEAFRVSTNKENEKAGLKVTMLAFLIKASVAALKKFPEFNASLDGDQLVYKQYY
HIGFAADTPNGLVVPVLKDADKKGVLQISQEMGELAKKARDGKLTPAEMQGASFTISSLG
GIGGRYFTPIINAPEVAILGVSKSQMEPVWDGKAFQPRLMLPMSLAWDHRVIDGAGAARF
NAYLGQILADFRRVLL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggtagatattcaggttcctgatattggggacttcgacgaagtgacggtgatt
gagttgctcgtcaaaccaggcgataccgtgaaggctgagcaatccctgatcacggtggag
tccgacaaggcctccatggagattccgtccagccaggctggcgtggtcaaggagctcaag
gtcaagctcggagacaaggtcaagcagggttccatcgtgctgacggtggaagcggccggc
gccgcagtaccggcaacagcatcggctgcggcagcttctgctgcacccgctgcgagcacg
gcggcagcaccggcgcctgcccccgcaccggcgccagtcccggcgtcggcgccggccgca
gctgccggcccggtcgaggtccgtgtacccgacatcggcgacttcaaggatgtgtcggtc
atcgaggtgctcgtcaagccgggcgacaccatcaagctcgagcagtccctggtcaccgtg
gagtccgacaaggcttcgatggagattccgtcgtcggccgcgggcgtactcaaggaactc
aaggtcaagctgggcgacatcgtcaacatcggtgatctgctggccattctggaaggctct
gttgcagccaccgggacctccccggcgcccgcaccggctgcaccggccgccgcccctgca
cctgtttctgcggcggccgccgcgccggctgctgcggtcatgccggcgcatgagcccgcc
acggcccagcaaggcagtttgccgcatgcttcgccctcggtgcgcaagttcgcccgcgag
ctcggcgtgcccctggcagaggtcaaaggcacaggtccgaagggccgcatcacgcaggac
gacgtgcaggccttcaccaagtcggtcatggcgggcgatacccgcacccaggcgcaggct
gccaaggcacccgcatcgtccggtggtaccggcgtgggactggacctgctgccatggccc
aaggtcgacttcaccaagttcgggccagtcgagcgcaaggacatgtcccgcatcaagaag
atcagcggcgccaacctgcttcgcaactacgtgatgatcccgcacgtcaccaaccatgac
gatgccgacatcaccgagctggaagctttccgcgtttcgaccaacaaggaaaacgagaag
gcaggcctgaaggtcaccatgctggccttcctgatcaaggccagcgttgcggcgctgaag
aaattccccgaattcaatgcctcgctggacggcgaccaactggtttacaagcagtactac
cacatcggttttgccgccgacacgcccaacgggttggtcgttcccgtactcaaggatgcc
gacaaaaaaggcgtgctgcagatcagccaggaaatgggcgaactcgcgaagaaggcgcgc
gacggcaagctcacgcccgccgaaatgcagggcgccagcttcaccatctcgtcgctgggc
ggcattggcgggcgttacttcacgcccatcatcaacgcgccggaagtcgccatcctcggc
gtctccaagagccagatggaacctgtgtgggatggcaaggccttccagccgcgcctgatg
ctgcccatgtcgctggcctgggaccaccgcgtgatcgacggcgccggcgccgcgcgcttc
aacgcctatctcggacaaatcctcgccgacttccgccgcgttcttttatga

DBGET integrated database retrieval system