KEGG   Polaromonas sp. JS666: Bpro_2689Help
Entry
Bpro_2689         CDS       T00343                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00900  Terpenoid backbone biosynthesis
pol01100  Metabolic pathways
pol01110  Biosynthesis of secondary metabolites
pol01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bpro_2689
Enzymes [BR:pol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Bpro_2689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABE44605
JGI: Bpro2689
UniProt: Q12A37
Position
complement(2830745..2831932)
Genome map
AA seq 395 aa AA seqDB search
MSFKKQRITVLGSTGSIGVNTLDVIASHPERFEVFALSAATQVDLMLAQCMQFRPQYAVM
VSEPHARLLAEKVKENQLPVQVLWVPDALEMIASHELVDTVMAAIVGAAGLAPCMAAARA
GKRLLLANKEALVVGGEVFMQAVRAGGAQLLPIDSEHSAIFQSLPEDPASWPQRVEKIIL
TASGGPFRTREPGSLRHVTPDEACAHPNWVMGRKISVDSATMMNKALEVIEAKYLFGLTP
QQIEVVIHPQSIIHSMVQYRDTSVVAQLGTPDMRVPIAYGLAWPDRITSGARALDFTALA
TMTFEVPDHERFPGLPLAWEVLNAPVGSTAVLNAANEAAVAAFLDRRIRFDHIHHVNHAT
LDAMAVSDVNDIEGLLALDARARLVAGQIIERLEP
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcaaaaaacagcgtatcaccgttctgggttcaaccggctccattggcgtcaac
acacttgacgtgattgccagccatccggagcgctttgaggtgtttgcgctcagtgcggca
acccaggtcgacctgatgctggcgcagtgcatgcagttcaggccgcaatatgccgtgatg
gtgagcgagccgcatgcccgcctgctggctgaaaaggtcaaggaaaatcagcttcctgtc
caggttttatgggtgcctgatgctctcgaaatgatagcgtctcatgagctggtggacacc
gtgatggccgccattgtgggtgcggctggcctggcgccctgtatggccgccgccagggcg
ggcaaacgcctgttgctggccaacaaggaagcgctcgtggtcggcggagaggtcttcatg
caggcggttcgtgcgggcggcgcgcagctgctgcccatcgacagcgagcattcggccatt
ttccagtccctgccggaggatccggccagctggccgcagcgtgtcgagaaaatcatcctg
acagcgtccggcgggcctttccggacccgggagccgggcagcctgcggcatgtgacgccc
gatgaagcgtgcgcgcacccgaactgggtgatggggcgcaagatatcggttgattccgcc
accatgatgaacaaggccctggaggtcatcgaggccaagtacctgttcggcctgacgccg
cagcagatcgaggtggtgatccatccgcagagcatcattcactccatggtgcagtaccgc
gatacgtcggtcgtggcgcaactggggacgcccgacatgcgcgtgcccatcgcctatggc
ctggcctggccggaccgcattacctcgggggcccgggcgctggatttcaccgcgttggcg
accatgacttttgaggtgcccgatcatgagcggtttcctggactgccgctggcctgggag
gtcctcaatgcaccggtgggcagcacggcggtgctcaatgcggccaacgaggcggcggtg
gccgcatttctggaccggcgcatccgctttgaccacatccaccatgtaaatcatgcaact
ttggatgccatggcggtctcagatgtgaacgatatcgagggattgctggcactggacgcg
cgggcgcgccttgttgccggtcaaatcattgaacgtctggagccatga

DBGET integrated database retrieval system