KEGG   Polaromonas sp. JS666: Bpro_2705Help
Entry
Bpro_2705         CDS       T00343                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
pol  Polaromonas sp. JS666
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pol00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:pol00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2850896..2851678
Genome map
AA seq 260 aa AA seqDB search
MLKGKTALVTGSTSGIGLGIAKSLAAQGANIVLNGFGDVDGPKAEILALGVKVAYHGADM
SKPADIEDMMKFAASQFGQVDILVNNAGIQHVARVENFPVEKWDAVIAINLTSAFHATRL
ALPAMLAADNGKGWGRIINIASVHGLVGSAEKSAYVAAKHGIVGLTKVTALENATSGVTC
NAICPGWVLTPLVQKQVDARAAAGNISIEAATQQLLGEKEPSMRFTTPEELGALAVFFCS
AAGNNVRGVAWNMDGGWTAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaggtaaaacagctctcgttaccggctccaccagcggcatcggcctgggcatt
gccaaatccctcgccgcacagggcgccaacatcgtcctcaatgggtttggcgatgtggac
gggcccaaggcggagatcctggcgctcggcgtcaaggtggcctaccacggtgccgacatg
agcaagcccgcagacattgaagacatgatgaaattcgccgcctcgcagttcgggcaggtc
gacattctcgtcaacaacgcgggcatccagcatgtggcccgggtagaaaacttcccggtt
gaaaaatgggatgcggtcatcgcgatcaacctgaccagcgcctttcatgccacacgcctg
gcgctgcccgccatgctggccgcggacaatggcaagggctggggccgcatcatcaatatc
gcctcggtgcatggcctcgtcggctccgcggaaaaatcagcctatgtggcggccaagcac
ggcattgtcggactgaccaaggtcaccgcgcttgagaacgccaccagcggcgtgacctgc
aacgccatctgccccggttgggtgctgacacccctggtacaaaaacaggtggatgccagg
gctgcggcgggaaatatttccatcgaggcagccacccagcagctgctgggtgaaaaagaa
ccttcgatgcgattcaccacgcccgaagaactgggcgcgctggcggtgttcttctgctct
gcggcgggcaacaatgtacgcggcgtcgcgtggaacatggacggcggctggacggcgcag
taa

DBGET integrated database retrieval system