KEGG   Polaromonas sp. JS666: Bpro_2756Help
Entry
Bpro_2756         CDS       T00343                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
pol  Polaromonas sp. JS666
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bpro_2756
   01230 Biosynthesis of amino acids
    Bpro_2756
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bpro_2756
   00030 Pentose phosphate pathway
    Bpro_2756
   00051 Fructose and mannose metabolism
    Bpro_2756
   00052 Galactose metabolism
    Bpro_2756
  Energy metabolism
   00680 Methane metabolism
    Bpro_2756
Enzymes [BR:pol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Bpro_2756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2899017..2899955
Genome map
AA seq 312 aa AA seqDB search
MTDILTITMNPALDVSTSTDKVMDTHKLRCAAAQLHPGGGGINVARVVQRLGSDCIALFL
AGGINGQLLRQLLDREQVRSHWIPIAGETRESFSVHETSSGKDFRFVLPGPTLTAPEWQA
CLDFVSKLGVPAAYVVASGGLPPGVPGDFYAQLTRLTRSRGSRVVVDTWGPALAAALAEG
VYLIKPSLQELRELTGLPLADEPQWREAAKRIILAGHAQVVALSLGEDGALLVTADRTLR
ARAVPVKVASTIGAGDSFVGGLVWALNRGDDLEQAFRYGMASGAAALLTAGTALGQAADV
ERLSKDVIVEPA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcctgaccatcaccatgaacccggccctggacgtctccacctcgaccgac
aaggtcatggacacgcacaagctgcggtgcgctgccgcgcaattgcatcctggcggcggc
gggatcaacgtggctcgcgtcgtgcagcggctcggcagcgactgcattgcgctctttctg
gctgggggcataaacgggcaactgctgcggcaactgctggaccgggagcaggtgcgcagc
cactggatccccattgccggggaaacccgtgagagcttttccgtccacgaaacatccagc
gggaaggacttccgctttgtactgcccggcccgaccctgacggcgccggagtggcaggcc
tgcctggactttgtcagcaagctcggcgtgcctgccgcttatgtggtggcgagcggcggc
ctgcccccgggggtacctggcgacttttatgctcaactcacgcggctgacccgctcgcgc
ggcagccgggtggtggtggacacgtgggggccggcgctggcggcggccctggcagaaggg
gtgtacctgatcaagcccagccttcaggaactgcgcgagttgaccggcttgccgctggct
gacgaaccgcaatggcgcgaggcggcaaagcggatcatcctggcggggcacgcgcaggtc
gtggcgctgtcgctcggcgaggacggcgccctgctcgtcaccgcagaccggactctgcgg
gcccgggcagtaccggtcaaggtggccagcaccatcggggcgggtgacagctttgtcggc
ggcctggtctgggcgctgaaccgcggcgacgacctggagcaggcgtttcgttacggcatg
gcgtccggcgcggcggccctgctcactgcgggaacggccctgggccaggcggccgatgtt
gagcgccttagcaaggacgtgatcgtcgaaccagcctga

DBGET integrated database retrieval system