KEGG   Polaromonas sp. JS666: Bpro_2756Help
Entry
Bpro_2756         CDS       T00343                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
pol  Polaromonas sp. JS666
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:pol01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pol01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pol00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pol00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pol00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pol00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:pol00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2899017..2899955
Genome map
AA seq 312 aa AA seqDB search
MTDILTITMNPALDVSTSTDKVMDTHKLRCAAAQLHPGGGGINVARVVQRLGSDCIALFL
AGGINGQLLRQLLDREQVRSHWIPIAGETRESFSVHETSSGKDFRFVLPGPTLTAPEWQA
CLDFVSKLGVPAAYVVASGGLPPGVPGDFYAQLTRLTRSRGSRVVVDTWGPALAAALAEG
VYLIKPSLQELRELTGLPLADEPQWREAAKRIILAGHAQVVALSLGEDGALLVTADRTLR
ARAVPVKVASTIGAGDSFVGGLVWALNRGDDLEQAFRYGMASGAAALLTAGTALGQAADV
ERLSKDVIVEPA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcctgaccatcaccatgaacccggccctggacgtctccacctcgaccgac
aaggtcatggacacgcacaagctgcggtgcgctgccgcgcaattgcatcctggcggcggc
gggatcaacgtggctcgcgtcgtgcagcggctcggcagcgactgcattgcgctctttctg
gctgggggcataaacgggcaactgctgcggcaactgctggaccgggagcaggtgcgcagc
cactggatccccattgccggggaaacccgtgagagcttttccgtccacgaaacatccagc
gggaaggacttccgctttgtactgcccggcccgaccctgacggcgccggagtggcaggcc
tgcctggactttgtcagcaagctcggcgtgcctgccgcttatgtggtggcgagcggcggc
ctgcccccgggggtacctggcgacttttatgctcaactcacgcggctgacccgctcgcgc
ggcagccgggtggtggtggacacgtgggggccggcgctggcggcggccctggcagaaggg
gtgtacctgatcaagcccagccttcaggaactgcgcgagttgaccggcttgccgctggct
gacgaaccgcaatggcgcgaggcggcaaagcggatcatcctggcggggcacgcgcaggtc
gtggcgctgtcgctcggcgaggacggcgccctgctcgtcaccgcagaccggactctgcgg
gcccgggcagtaccggtcaaggtggccagcaccatcggggcgggtgacagctttgtcggc
ggcctggtctgggcgctgaaccgcggcgacgacctggagcaggcgtttcgttacggcatg
gcgtccggcgcggcggccctgctcactgcgggaacggccctgggccaggcggccgatgtt
gagcgccttagcaaggacgtgatcgtcgaaccagcctga

DBGET integrated database retrieval system