KEGG   Polaromonas sp. JS666: Bpro_3100Help
Entry
Bpro_3100         CDS       T00343                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pol  Polaromonas sp. JS666
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bpro_3100
   00052 Galactose metabolism
    Bpro_3100
Enzymes [BR:pol01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Bpro_3100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3272315..3273448)
Genome map
AA seq 377 aa AA seqDB search
MPPIQPVSPPPHAGAVLLDPARFRGDIDGKPVGLFTLRNQRGMVAGITSYGAKIEQLLVP
DRDGLLDDVVLGYDSLEAVVNGSASMGAFVGRYAGRIENARFTLGGTGHVLTANNGCHCL
HGGQKGSRFRVFDAAQRDDASVEMRYVFADGEEGFPGTLALRLVYSVTEANELQLDYEAL
ALDKPTVASFTTHAFFNLNGEASGSAMGHEVMICADRYFGMTTDLIATGEILPVAGTPFD
LRQATALNTRVPGTPQADAGTPPRDGVDGYDSCFLLDHPADGTLALCARVRAPESGRVME
VWSTEPALQFYSGLQPQEPLAGGPGKGGRTYFQQQGLCFEPQGYPNAPNRPAFPSSVHVP
GQRRVGRTVYRFSTDPV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgatccaacccgtatcgccaccaccgcacgcgggcgctgtcctgctcgatcct
gcccgttttcgcggcgatatcgatggcaaaccggtcgggctgttcacgctgcgcaatcag
cggggcatggtggcgggcatcaccagttacggcgccaagatcgagcagctgctggtgccc
gaccgtgacggcctgctggacgacgtggtgcttggctatgacagcctggaggctgtggtg
aatggctcggcgtccatgggcgcctttgtggggcgttatgcggggcgcatcgagaatgcc
cgcttcacactgggcgggaccgggcatgtgctgacggccaacaacggctgccattgcctg
cacggcgggcagaaggggtcgcgctttcgcgtcttcgatgccgctcagcgtgacgatgcc
agcgtggaaatgcgctatgtatttgccgacggggaagagggcttccccggcacgctggcg
ctgcgcctggtctatagcgtcaccgaagccaatgagctccagctggactatgaagccctg
gccctggacaaacccacggtggccagtttcaccacgcatgcttttttcaacttgaatggc
gaggccagcggtagcgcgatgggtcatgaggtcatgatttgtgcggaccgctacttcggg
atgacaacagacctcatcgccaccggcgagatcctgccggtggcgggcaccccctttgac
ctccgccaggccaccgcgctcaatacgcgggtgccgggtacgccgcaggccgatgccggg
acgcctccgagggatggggtggacggctacgacagctgttttctgctggaccatcccgcc
gatggcacgctggccctgtgcgcccgcgttcgcgcgccggaaagcggccgggtgatggaa
gtctggtcgacagagccggccctgcagttctacagcggcttgcagccgcaagagccgttg
gcgggtggcccgggcaagggtggccggacctacttccagcagcaagggctgtgctttgag
ccacagggctatcccaacgcacccaaccggccggcatttccgtcatcggtgcatgtaccc
ggccagcgccgggtgggccgcacggtgtaccggttcagcacggacccggtgtga

DBGET integrated database retrieval system