KEGG   Polaromonas sp. JS666: Bpro_3258Help
Entry
Bpro_3258         CDS       T00343                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pol  Polaromonas sp. JS666
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bpro_3258 (tpiA)
   01230 Biosynthesis of amino acids
    Bpro_3258 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bpro_3258 (tpiA)
   00051 Fructose and mannose metabolism
    Bpro_3258 (tpiA)
   00562 Inositol phosphate metabolism
    Bpro_3258 (tpiA)
Enzymes [BR:pol01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bpro_3258 (tpiA)
Exosome [BR:pol04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bpro_3258 (tpiA)
  Exosomal proteins of bladder cancer cells
   Bpro_3258 (tpiA)
  Exosomal proteins of melanoma cells
   Bpro_3258 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3447875..3448612)
Genome map
AA seq 245 aa AA seqDB search
MNGSLAANAALLEALGEGLKDLSLPLTCEVAVCVPAPYLAQVQGLKSSRSSLSALAVGAQ
DVSAQASGAYTGEVSAAMLQDFGCRYVIVGHSERRQYHGESDALVADKAKAALAAGITPI
VCIGETLAEREGGHTEEVVKRQLAAVIHVNGHCISEIVVAYEPVWAIGTGKTASPEEAQA
VHAVLRAQLRAATDHPMRVKILYGGSMNAANAAALLSQPDIDGGLIGGASLKAPDFLKII
AAAQI
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcagtctggctgccaatgccgcgttgctggaggcgctgggggaagggctgaaa
gacctgagcctcccgctcacctgcgaggtggccgtgtgcgtaccagcgccctacctggca
caggttcaaggcctgaaatcgagccgatccagcctgtcagccctggcagtgggggcgcag
gatgtttcggcgcaagcctcgggtgcctacaccggcgaggtcagtgcggccatgctccag
gacttcggctgccggtatgtgatcgtgggccattccgagcgtcgccagtaccacggcgaa
tcagatgcgctggtggccgacaaggccaaggcggcactggcggcagggatcacgcccatc
gtctgcattggtgaaacgctggccgagcgcgagggcggccacacggaagaggtggtcaag
cgccagcttgccgcggtgatccatgtcaacgggcactgcatcagcgagatcgtggtggcc
tacgaacccgtctgggccataggcaccggaaaaacggcttcgcccgaagaggcgcaggcg
gttcatgcggtgctgcgggcccagctcagggcggcgaccgaccatccgatgcgtgtgaaa
atcctgtacggcggcagcatgaatgcggccaatgcggcagcgctcctgagccagcccgac
atcgacggcggcctgataggcggcgcctcgctcaaagccccggattttttgaaaattatt
gctgcagcccagatttga

DBGET integrated database retrieval system