KEGG   Polaromonas sp. JS666: Bpro_3358Help
Entry
Bpro_3358         CDS       T00343                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00010  Glycolysis / Gluconeogenesis
pol00620  Pyruvate metabolism
pol00640  Propanoate metabolism
pol00680  Methane metabolism
pol01100  Metabolic pathways
pol01110  Biosynthesis of secondary metabolites
pol01120  Microbial metabolism in diverse environments
pol01130  Biosynthesis of antibiotics
pol01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bpro_3358
   00620 Pyruvate metabolism
    Bpro_3358
   00640 Propanoate metabolism
    Bpro_3358
  Energy metabolism
   00680 Methane metabolism
    Bpro_3358
Enzymes [BR:pol01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bpro_3358
Lipid biosynthesis proteins [BR:pol01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bpro_3358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N Spore_YhcN_YlaJ
Motif
Other DBs
NCBI-ProteinID: ABE45268
JGI: Bpro3358
UniProt: Q127M4
Position
complement(3553874..3555940)
Genome map
AA seq 688 aa AA seqDB search
MSKDKLPRHATEQQSADISEISEAQIAVHWPEEGYFSPSNPFIAQANLTDAGIFARFALD
KFPECFKEFADLLDWYKYWETTLDTSNPPFWRWFVGGKINACYNCVDRHLGQHKNKTAIH
FVPEPEDEAPQHLTYQELFVRVNEFAALLRDFCGLKAGDRVTLHMPMVAELPITMLACAR
LGVIHSQVFSGFSGKACADRVADSESRVLITMDAYHRAGNLLDHKEKADIAVMEAASHGQ
QVDKVLIWQRYPGKNSSPTKLVEGRDFVINDVLKQFRGKRVEPVQMPAEAPLFLMYTSGT
TGRPKGCQHGIGGYLAYVTWTSKFIQDIHPEDVYWCMADIGWITGHSYIVYGPLALAASS
VVYEGVPTYPDAGRPWRIAENLDVNIFHTSPTAIRALRRDGPDEPAKYNHHFKHMTTVGE
PIEPEVWKWYHRMVGKGEAVIVDTWWQTENGGFLCSTVPAIHKMKPGSTGPAIPGIHPVI
YDDEGKELVSGSGKAGNICIRNPWPGGFQTIWKDPERYVRQYYARYCADPKSKDWRDWPY
MAGDGAVQAADGYYRILGRIDDVINVAGHRLGTKEIESAALLVPEVVEAAVVPVADPIKG
KVPDLYVALKPGLAPSEEIANRVSASVVSEIGAIARPRRVIVVPDMPKTRSGKIMRRVLA
AISNHLDPGDVSTLANPEVVDKIKELAK
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagacaagttgccgcgccacgccaccgagcagcagagtgccgatatctccgag
atctccgaggcccagatcgcggtgcattggccggaggagggctacttctcgccgtccaac
cccttcatcgcgcaggccaatttgacggacgcgggcatcttcgcgcgttttgccctcgac
aagtttcccgagtgcttcaaggagttcgcggacctgctggactggtacaagtactgggag
acgacgctcgacaccagcaatcccccgttctggcgctggttcgtcggcggcaagatcaac
gcttgctacaactgcgtggaccgccaccttggccagcacaagaacaagacggcgatccat
tttgtgcccgagccggaggacgaggcgccacagcacctcacctaccaggagcttttcgtg
cgcgtcaacgagttcgcggccttgttgcgtgacttctgcggcctgaaggcgggcgaccgg
gtgaccttgcatatgccgatggtggcggagctgcccatcaccatgcttgcctgcgcgcgg
ctcggcgtgattcactcgcaggtgttcagcggattcagcggcaaggcctgcgccgaccgc
gtcgcggattccgagagccgcgtgttgatcaccatggacgcctatcaccgcgccggcaat
ctgctggaccataaggagaaagccgacatcgcggtcatggaggccgccagccacggccaa
caggtcgacaaggtgctgatctggcagcgctacccgggcaaaaactccagccccacgaag
ctcgtggaaggacgcgacttcgtcatcaacgacgtcctcaagcagttccgtggcaagcgt
gtcgagcccgtgcagatgccggcagaggcgccgcttttcctgatgtacacgagcggcacg
acggggcggcccaaaggctgccagcacggcatcggcggctacctcgcctacgtcacctgg
acatcgaagttcatccaggacatccaccccgaggacgtgtactggtgcatggccgacatc
ggctggatcacaggccattcctacatcgtctacggcccgctggcgctcgccgcttcttcg
gtggtgtacgaaggtgtgccaacctatccggacgccggacggccctggcgtatcgctgaa
aacctcgacgtcaatatcttccacacgtcgcccaccgcgatccgcgcgctacggcgcgac
ggacccgacgagcccgccaagtacaaccaccacttcaaacacatgacgaccgtgggcgag
ccgatcgagcccgaagtctggaagtggtaccaccgcatggtcggcaagggcgaagcagtg
atcgtggacacctggtggcagaccgaaaacggcggattcctttgcagcacggtgccggcg
atccacaagatgaagcccggcagcacgggccccgcgattccaggcattcatccggtgatc
tacgacgacgagggcaaggagcttgtgagcggttcgggcaaggcgggcaacatctgcatc
cgcaacccctggcccggtggtttccagaccatctggaaagaccccgagcgctacgtgcgc
cagtactacgcgcgctattgcgcagatcccaagagcaaagactggcgcgactggccctac
atggcgggtgatggcgcggtgcaggcggccgacggttactaccggatcctcggccgcatc
gacgacgtgatcaacgtcgccggccatcgcctgggcaccaaggaaatcgaatcggccgcg
ctgctcgtgcccgaggtcgtcgaagcggccgtggttccagtcgccgacccgatcaagggc
aaggtgcccgacctctatgttgcgttgaagccgggactggcgccttccgaggagatcgcg
aacagggtctcggcatcggtcgtgtccgagatcggcgccatcgcgcggcctcgccgagtg
attgtcgttcccgatatgcccaagacccgctcgggaaagatcatgcgccgcgtgctcgcg
gcgatctcgaatcacctggatcctggcgacgtgtccaccctcgccaatccggaggtcgtc
gacaagatcaaggagctggccaagtag

DBGET integrated database retrieval system