KEGG   Polaromonas sp. JS666: Bpro_3501Help
Entry
Bpro_3501         CDS       T00343                                 

Definition
class I cytochrome c
Orthology
K08738  
cytochrome c
Organism
pol  Polaromonas sp. JS666
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Bpro_3501
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bpro_3501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3699182..3699859
Genome map
AA seq 225 aa AA seqDB search
MALVSFVRIALLGIAGGVSFVAPSYGAEDVERGAQVSRSCMACHSFSPGRHMTGPSLAGV
WGRRAGTAAGFSRYSDALKRSEIVWTEKSLDAWLRKPAALIPGNTMLFDGIPDPGTRADL
LAYLQAVSEGRASAPERGLPNLKRVDASSQVTAIRYCGDAYRVLTGDGKSRTWWEFNLRF
KTDGSPDGPSTGKPVIVGSGMQGDRAAVVFSRPEEISMFIRRECP
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggctcttgtaagcttcgtccgcatcgccctcctggggatcgccgggggggtctcgttc
gttgccccgtcttatggtgcagaagacgtcgagcgcggcgcacaggtgtcgcgttcctgc
atggcctgtcattcgttctcgcccgggcgccacatgaccggcccgagcctcgcaggggtg
tggggccgccgggcgggcaccgccgccgggttcagccgctattcggatgcgctgaagcgc
tcggaaatcgtctggaccgagaagtccctggatgcatggctccgaaagccggcggcgttg
attccgggcaacaccatgctcttcgatggcataccggacccgggtacgcgcgccgatctg
ctggcatatctccaggccgtgtccgaaggtcgcgcttcggcaccggagcgcgggctgccg
aacctcaagcgcgtcgacgcgtccagccaggtgaccgcgatccgctattgcggcgatgcc
taccgcgtcctcaccggcgacggcaagagccgcacctggtgggaattcaacctgcggttc
aagaccgacggcagccccgacgggccgtcgaccggcaagccggtcatcgtcggcagcggc
atgcagggggaccgggccgcggtcgtcttctcgcgccccgaggagatatcgatgttcatt
cgaagggagtgcccgtga

DBGET integrated database retrieval system